Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 905950..906576 | Replicon | chromosome |
Accession | NZ_LS483498 | ||
Organism | Morganella morganii strain NCTC12028 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A0A2RCL2 |
Locus tag | DQM84_RS04225 | Protein ID | WP_024474604.1 |
Coordinates | 905950..906153 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J7U1S9 |
Locus tag | DQM84_RS04230 | Protein ID | WP_004236473.1 |
Coordinates | 906217..906576 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM84_RS04205 | 902506..902844 | + | 339 | WP_004236467.1 | P-II family nitrogen regulator | - |
DQM84_RS04210 | 902864..904153 | + | 1290 | WP_015422958.1 | ammonium transporter AmtB | - |
DQM84_RS04215 | 904214..905077 | - | 864 | WP_004236469.1 | acyl-CoA thioesterase II | - |
DQM84_RS04225 | 905950..906153 | - | 204 | WP_024474604.1 | hemolysin expression modulator Hha | Toxin |
DQM84_RS04230 | 906217..906576 | - | 360 | WP_004236473.1 | Hha toxicity modulator TomB | Antitoxin |
DQM84_RS04235 | 907139..910315 | - | 3177 | WP_015422956.1 | multidrug efflux RND transporter permease subunit | - |
DQM84_RS04240 | 910330..911526 | - | 1197 | WP_015422955.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8073.39 Da Isoelectric Point: 6.9770
>T292667 WP_024474604.1 NZ_LS483498:c906153-905950 [Morganella morganii]
MTKLDYLMRLRKCTSIETLERVIEKNKYELTDDELEVFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKLDYLMRLRKCTSIETLERVIEKNKYELTDDELEVFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13826.54 Da Isoelectric Point: 4.2870
>AT292667 WP_004236473.1 NZ_LS483498:c906576-906217 [Morganella morganii]
MDEYSPRNYDIAVLKYLCDELCREGTQTLIRSNNYWVNDLASDSNLKLNELLGYIADVAWSFKIKHTQNKDLISFVDEYI
DETYALFGQMEVSFNDVEEWKKMASLVSSMLTSEGHLVH
MDEYSPRNYDIAVLKYLCDELCREGTQTLIRSNNYWVNDLASDSNLKLNELLGYIADVAWSFKIKHTQNKDLISFVDEYI
DETYALFGQMEVSFNDVEEWKKMASLVSSMLTSEGHLVH
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2RCL2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | J7U1S9 |