Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 689347..689984 | Replicon | chromosome |
Accession | NZ_LS483496 | ||
Organism | Haemophilus influenzae strain NCTC8455 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | A0A121YHB9 |
Locus tag | DQL17_RS03530 | Protein ID | WP_021035685.1 |
Coordinates | 689580..689984 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | A0A0H3PN67 |
Locus tag | DQL17_RS03525 | Protein ID | WP_005656316.1 |
Coordinates | 689347..689583 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL17_RS03500 | 684724..685464 | - | 741 | WP_005662961.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
DQL17_RS03505 | 685477..685950 | - | 474 | WP_050948992.1 | dihydroneopterin triphosphate diphosphatase | - |
DQL17_RS03510 | 685972..687738 | - | 1767 | WP_050948993.1 | aspartate--tRNA ligase | - |
DQL17_RS03515 | 687957..688475 | + | 519 | WP_005688985.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
DQL17_RS03520 | 688529..689254 | + | 726 | WP_111688884.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
DQL17_RS03525 | 689347..689583 | + | 237 | WP_005656316.1 | antitoxin | Antitoxin |
DQL17_RS03530 | 689580..689984 | + | 405 | WP_021035685.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DQL17_RS03535 | 690051..690458 | + | 408 | WP_005688980.1 | lactoylglutathione lyase | - |
DQL17_RS03540 | 690532..691221 | + | 690 | WP_021035684.1 | ribonuclease T | - |
DQL17_RS03545 | 691535..692887 | + | 1353 | WP_050948995.1 | Na+/H+ antiporter family protein | - |
DQL17_RS03550 | 692919..693503 | + | 585 | WP_050948996.1 | primosomal replication protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15690.26 Da Isoelectric Point: 8.9777
>T292664 WP_021035685.1 NZ_LS483496:689580-689984 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFSSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFSSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A121YHB9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3PN67 |