Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 245309..245913 | Replicon | chromosome |
Accession | NZ_LS483496 | ||
Organism | Haemophilus influenzae strain NCTC8455 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A837MVY4 |
Locus tag | DQL17_RS01235 | Protein ID | WP_050846512.1 |
Coordinates | 245605..245913 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q4QMK8 |
Locus tag | DQL17_RS01230 | Protein ID | WP_005692346.1 |
Coordinates | 245309..245605 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL17_RS01215 | 241075..242460 | + | 1386 | WP_075985656.1 | L-seryl-tRNA(Sec) selenium transferase | - |
DQL17_RS01220 | 242457..244316 | + | 1860 | WP_075985657.1 | selenocysteine-specific translation elongation factor | - |
DQL17_RS01225 | 244335..245189 | + | 855 | WP_075985658.1 | DUF3298 domain-containing protein | - |
DQL17_RS01230 | 245309..245605 | + | 297 | WP_005692346.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DQL17_RS01235 | 245605..245913 | + | 309 | WP_050846512.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
DQL17_RS01240 | 245972..249088 | - | 3117 | WP_111688773.1 | TonB-dependent receptor | - |
DQL17_RS01245 | 249418..250716 | + | 1299 | WP_075985659.1 | trigger factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11920.68 Da Isoelectric Point: 7.8657
>T292661 WP_050846512.1 NZ_LS483496:245605-245913 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGNLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGNLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837MVY4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4QMK8 |