Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | VapXD/- |
| Location | 179943..180421 | Replicon | chromosome |
| Accession | NZ_LS483496 | ||
| Organism | Haemophilus influenzae strain NCTC8455 | ||
Toxin (Protein)
| Gene name | VapD | Uniprot ID | A0A0K9L551 |
| Locus tag | DQL17_RS00935 | Protein ID | WP_050848517.1 |
| Coordinates | 179943..180221 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | VapX | Uniprot ID | A0A0K9KX05 |
| Locus tag | DQL17_RS00940 | Protein ID | WP_012055040.1 |
| Coordinates | 180230..180421 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL17_RS00915 | 175131..176801 | - | 1671 | WP_110430653.1 | fructose-specific PTS transporter subunit EIIC | - |
| DQL17_RS00920 | 176803..177744 | - | 942 | WP_111688762.1 | 1-phosphofructokinase | - |
| DQL17_RS00925 | 177746..179245 | - | 1500 | WP_050948745.1 | fused PTS fructose transporter subunit IIA/HPr protein | - |
| DQL17_RS00930 | 179317..179847 | - | 531 | WP_050948746.1 | hypothetical protein | - |
| DQL17_RS00935 | 179943..180221 | - | 279 | WP_050848517.1 | virulence-associated protein VapD | Toxin |
| DQL17_RS00940 | 180230..180421 | - | 192 | WP_012055040.1 | DUF5397 family protein | Antitoxin |
| DQL17_RS00945 | 180492..181790 | - | 1299 | WP_074040071.1 | hemolysin family protein | - |
| DQL17_RS00950 | 181841..182365 | - | 525 | WP_005669286.1 | DUF1523 family protein | - |
| DQL17_RS00955 | 182392..183174 | - | 783 | WP_111688763.1 | YchF/TatD family DNA exonuclease | - |
| DQL17_RS00960 | 183213..184193 | - | 981 | WP_050948750.1 | DNA polymerase III subunit delta' | - |
| DQL17_RS00965 | 184190..184822 | - | 633 | WP_050948790.1 | dTMP kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10604.98 Da Isoelectric Point: 5.7408
>T292660 WP_050848517.1 NZ_LS483496:c180221-179943 [Haemophilus influenzae]
MYAIAFDLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYTNTNEDMANLFQAMNSLKQLAWISQSVRDIRAFRI
EQWSDFTDFIRS
MYAIAFDLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYTNTNEDMANLFQAMNSLKQLAWISQSVRDIRAFRI
EQWSDFTDFIRS
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9L551 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9KX05 |