Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 957674..958340 | Replicon | chromosome |
Accession | NZ_LS483492 | ||
Organism | Serratia rubidaea strain NCTC10848 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | DQN11_RS04510 | Protein ID | WP_105232394.1 |
Coordinates | 957921..958340 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | DQN11_RS04505 | Protein ID | WP_105232395.1 |
Coordinates | 957674..957940 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN11_RS04480 | 952830..953483 | + | 654 | WP_105232400.1 | hypothetical protein | - |
DQN11_RS04485 | 953480..954799 | + | 1320 | WP_105232399.1 | MHS family MFS transporter | - |
DQN11_RS04490 | 954831..955439 | - | 609 | WP_105232398.1 | HD domain-containing protein | - |
DQN11_RS04495 | 955634..956314 | + | 681 | WP_105232397.1 | hemolysin III family protein | - |
DQN11_RS04500 | 956351..957343 | - | 993 | WP_105232396.1 | tRNA-modifying protein YgfZ | - |
DQN11_RS04505 | 957674..957940 | + | 267 | WP_105232395.1 | FAD assembly factor SdhE | Antitoxin |
DQN11_RS04510 | 957921..958340 | + | 420 | WP_105232394.1 | hypothetical protein | Toxin |
DQN11_RS04515 | 958371..958889 | - | 519 | WP_105232393.1 | flavodoxin FldB | - |
DQN11_RS04520 | 958981..959880 | + | 900 | WP_105232392.1 | site-specific tyrosine recombinase XerD | - |
DQN11_RS04525 | 959908..960624 | + | 717 | WP_015673664.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
DQN11_RS04530 | 960637..962367 | + | 1731 | WP_105232391.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16481.54 Da Isoelectric Point: 11.5037
>T292655 WP_105232394.1 NZ_LS483492:957921-958340 [Serratia rubidaea]
VAQWRCDVRISWRTQLISLLAHGALILLILISPWPESYDPVWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLVRRPWMLRYGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRMRLVKDESEG
VAQWRCDVRISWRTQLISLLAHGALILLILISPWPESYDPVWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLVRRPWMLRYGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRMRLVKDESEG
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|