Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1613467..1613996 | Replicon | chromosome |
| Accession | NZ_LS483491 | ||
| Organism | Staphylococcus auricularis strain NCTC12101 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2K4C3I5 |
| Locus tag | DQL57_RS07645 | Protein ID | WP_059107861.1 |
| Coordinates | 1613467..1613829 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A2K4C4W9 |
| Locus tag | DQL57_RS07650 | Protein ID | WP_059107862.1 |
| Coordinates | 1613826..1613996 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL57_RS07625 | 1610377..1611147 | - | 771 | WP_059107857.1 | RNA polymerase sigma factor SigB | - |
| DQL57_RS07630 | 1611122..1611601 | - | 480 | WP_059107858.1 | anti-sigma B factor RsbW | - |
| DQL57_RS07635 | 1611603..1611929 | - | 327 | WP_059107859.1 | anti-sigma factor antagonist | - |
| DQL57_RS07640 | 1612006..1613007 | - | 1002 | WP_059107860.1 | PP2C family protein-serine/threonine phosphatase | - |
| DQL57_RS07645 | 1613467..1613829 | - | 363 | WP_059107861.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DQL57_RS07650 | 1613826..1613996 | - | 171 | WP_059107862.1 | hypothetical protein | Antitoxin |
| DQL57_RS07655 | 1614087..1615235 | - | 1149 | WP_059107863.1 | alanine racemase | - |
| DQL57_RS07660 | 1615585..1615944 | - | 360 | WP_059107864.1 | holo-ACP synthase | - |
| DQL57_RS07665 | 1616002..1616754 | - | 753 | WP_059107865.1 | PH domain-containing protein | - |
| DQL57_RS07670 | 1616747..1618255 | - | 1509 | WP_059107866.1 | PH domain-containing protein | - |
| DQL57_RS07675 | 1618248..1618727 | - | 480 | WP_059107867.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13664.98 Da Isoelectric Point: 10.2885
>T292654 WP_059107861.1 NZ_LS483491:c1613829-1613467 [Staphylococcus auricularis]
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIDKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMEEVNRAIFISLGLHNMKHFKS
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIDKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMEEVNRAIFISLGLHNMKHFKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K4C3I5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K4C4W9 |