Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 962971..963618 | Replicon | chromosome |
| Accession | NZ_LS483486 | ||
| Organism | Haemophilus influenzae strain NCTC12194 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | DQL18_RS05035 | Protein ID | WP_005642982.1 |
| Coordinates | 962971..963189 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A806ED58 |
| Locus tag | DQL18_RS05040 | Protein ID | WP_005642973.1 |
| Coordinates | 963217..963618 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL18_RS05000 | 958304..958672 | + | 369 | WP_005642993.1 | hypothetical protein | - |
| DQL18_RS05005 | 958672..958857 | + | 186 | WP_111722544.1 | hypothetical protein | - |
| DQL18_RS05010 | 958869..959150 | + | 282 | WP_015967401.1 | hypothetical protein | - |
| DQL18_RS05015 | 959228..961558 | + | 2331 | WP_111722546.1 | replication endonuclease | - |
| DQL18_RS05020 | 961641..961877 | + | 237 | WP_061724366.1 | hypothetical protein | - |
| DQL18_RS05025 | 961880..962386 | + | 507 | WP_061724365.1 | MazG-like family protein | - |
| DQL18_RS05030 | 962397..962915 | + | 519 | WP_061724364.1 | phage N-6-adenine-methyltransferase | - |
| DQL18_RS05035 | 962971..963189 | + | 219 | WP_005642982.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DQL18_RS05040 | 963217..963618 | + | 402 | WP_005642973.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DQL18_RS05045 | 963645..963905 | - | 261 | WP_080359101.1 | ogr/Delta-like zinc finger family protein | - |
| DQL18_RS05050 | 963986..965023 | - | 1038 | WP_111722548.1 | phage portal protein | - |
| DQL18_RS05055 | 965013..966836 | - | 1824 | WP_111722550.1 | terminase ATPase subunit family protein | - |
| DQL18_RS05060 | 967054..967947 | + | 894 | WP_048950705.1 | GPO family capsid scaffolding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 949023..985762 | 36739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8160.35 Da Isoelectric Point: 9.9306
>T292649 WP_005642982.1 NZ_LS483486:962971-963189 [Haemophilus influenzae]
VGIITTIERQEGETVDSKTAIKMIEEDGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLGHLEKSIKKQAGL
VGIITTIERQEGETVDSKTAIKMIEEDGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLGHLEKSIKKQAGL
Download Length: 219 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14922.06 Da Isoelectric Point: 4.3937
>AT292649 WP_005642973.1 NZ_LS483486:963217-963618 [Haemophilus influenzae]
MLYPICIEKVNDGYVVSVPDVPGCFSAGDTLSEAMLNAKEAISFHIEGMLEDDEELPKSNPIEQYINQPEYKDFIVTVVD
VDLTHLMGKAEKINITVPALLLHRIDQFIATHPEYKNRSNFLSQLATNRLLSA
MLYPICIEKVNDGYVVSVPDVPGCFSAGDTLSEAMLNAKEAISFHIEGMLEDDEELPKSNPIEQYINQPEYKDFIVTVVD
VDLTHLMGKAEKINITVPALLLHRIDQFIATHPEYKNRSNFLSQLATNRLLSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|