Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 744491..745128 | Replicon | chromosome |
| Accession | NZ_LS483486 | ||
| Organism | Haemophilus influenzae strain NCTC12194 | ||
Toxin (Protein)
| Gene name | VapC1 | Uniprot ID | E4QWH2 |
| Locus tag | DQL18_RS03905 | Protein ID | WP_005649049.1 |
| Coordinates | 744491..744895 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | VapB1 | Uniprot ID | E4QWH3 |
| Locus tag | DQL18_RS03910 | Protein ID | WP_005649046.1 |
| Coordinates | 744892..745128 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL18_RS03875 | 740045..740611 | + | 567 | WP_005544066.1 | elongation factor P | - |
| DQL18_RS03885 | 740968..741555 | - | 588 | WP_005654063.1 | primosomal replication protein | - |
| DQL18_RS03890 | 741588..742940 | - | 1353 | WP_105905462.1 | Na+/H+ antiporter family protein | - |
| DQL18_RS03895 | 743254..743943 | - | 690 | WP_011271988.1 | ribonuclease T | - |
| DQL18_RS03900 | 744017..744424 | - | 408 | WP_005688980.1 | lactoylglutathione lyase | - |
| DQL18_RS03905 | 744491..744895 | - | 405 | WP_005649049.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DQL18_RS03910 | 744892..745128 | - | 237 | WP_005649046.1 | antitoxin | Antitoxin |
| DQL18_RS03915 | 745221..745946 | - | 726 | WP_011271987.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
| DQL18_RS03920 | 745999..746517 | - | 519 | WP_005649040.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| DQL18_RS03925 | 746736..748502 | + | 1767 | WP_042594297.1 | aspartate--tRNA ligase | - |
| DQL18_RS03930 | 748524..748997 | + | 474 | WP_011271985.1 | dihydroneopterin triphosphate diphosphatase | - |
| DQL18_RS03935 | 749009..749749 | + | 741 | WP_005649034.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15692.29 Da Isoelectric Point: 8.9777
>T292648 WP_005649049.1 NZ_LS483486:c744895-744491 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|