Detailed information of TA system TA292647

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): hicAB/HicA-HicB
• Location: 664119..664763
• Replicon: chromosome
• Accession: NZ_LS483486
• Organism: Haemophilus influenzae strain NCTC12194

Toxin (Protein)

• Gene name: hicA
• Uniprot ID: -
• Locus tag: DQL18_RS03420
• Protein ID: WP_111722502.1
• Coordinates: 664578..664763 (-)
• Length: 62 a.a.

Antitoxin (Protein)

• Gene name: hicB
• Uniprot ID: -
• Locus tag: DQL18_RS03415
• Protein ID: WP_105891871.1
• Coordinates: 664119..664547 (-)
• Length: 143 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DQL18_RS03375	659520..660173	-	654	WP_044332609.1	helix-turn-helix domain-containing protein	-
DQL18_RS03380	660275..660457	+	183	WP_005655320.1	Cro/Cl family transcriptional regulator	-
DQL18_RS03385	660512..660952	+	441	WP_048950185.1	hypothetical protein	-
DQL18_RS03390	661001..661675	+	675	WP_038441201.1	phage antirepressor KilAC domain-containing protein	-
DQL18_RS03395	661672..662394	+	723	WP_111722498.1	helix-turn-helix domain-containing protein	-
DQL18_RS03400	662391..663017	+	627	WP_042602862.1	replication P	-
DQL18_RS03405	663014..663604	+	591	WP_111722500.1	adenine methyltransferase	-
DQL18_RS03410	663609..664118	+	510	WP_005692600.1	DUF1367 family protein	-
DQL18_RS03415	664119..664547	-	429	WP_105891871.1	type II toxin-antitoxin system HicB family antitoxin	Antitoxin
DQL18_RS03420	664578..664763	-	186	WP_111722502.1	type II toxin-antitoxin system HicA family toxin	Toxin
DQL18_RS03425	664919..665506	+	588	WP_111722504.1	recombination protein NinG	-
DQL18_RS03430	665508..665873	+	366	WP_111722506.1	RNA polymerase subunit sigma-70	-
DQL18_RS03435	665913..666431	+	519	WP_111722508.1	hypothetical protein	-
DQL18_RS03440	666542..667441	+	900	WP_013525610.1	hypothetical protein	-
DQL18_RS03450	667850..668362	+	513	WP_111722510.1	kinase	-
DQL18_RS03455	668541..668900	+	360	WP_032826240.1	phage holin, lambda family	-
DQL18_RS03460	668866..669468	+	603	WP_006995063.1	glycoside hydrolase family 19 protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	642605..695358	52753
	-	inside	Prophage	-	-	647256..695358	48102

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• HicA mRNA interferase family (4-60)

Antitoxin

• HicB-like antitoxin of toxin-antitoxin system (4-135)

Sequences

Toxin

Protein

• Length: 62 a.a.
• Molecular weight: 6706.84 Da
• Isoelectric Point: 11.1595

>T292647 WP_111722502.1 NZ_LS483486:c664763-664578 [Haemophilus influenzae]
MRSSDLIKELKSAGCTFVRHGKGDHQIWQSPITGKTFPVPHPKQHVSIGTLRSIKKSAGLL

Nucleotide

• Length: 186 bp

Antitoxin

Protein

• Length: 143 a.a.
• Molecular weight: 16398.34 Da
• Isoelectric Point: 4.3241

>AT292647 WP_105891871.1 NZ_LS483486:c664547-664119 [Haemophilus influenzae]
MLFTIGIETPTNENEAYGITVPALFTEEYSCFSAADTLEEIPTQATDAIHSILEIMFEDGIDINELQDKGYRHYQTQEDF
NYCDTWLLLDVDISAYQGKRHRINISLPEYLIKRIDSRVASNPIYKDRSHFLAVASQKELRQ

Nucleotide

• Length: 429 bp