Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 664119..664763 | Replicon | chromosome |
| Accession | NZ_LS483486 | ||
| Organism | Haemophilus influenzae strain NCTC12194 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | DQL18_RS03420 | Protein ID | WP_111722502.1 |
| Coordinates | 664578..664763 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | DQL18_RS03415 | Protein ID | WP_105891871.1 |
| Coordinates | 664119..664547 (-) | Length | 143 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL18_RS03375 | 659520..660173 | - | 654 | WP_044332609.1 | helix-turn-helix domain-containing protein | - |
| DQL18_RS03380 | 660275..660457 | + | 183 | WP_005655320.1 | Cro/Cl family transcriptional regulator | - |
| DQL18_RS03385 | 660512..660952 | + | 441 | WP_048950185.1 | hypothetical protein | - |
| DQL18_RS03390 | 661001..661675 | + | 675 | WP_038441201.1 | phage antirepressor KilAC domain-containing protein | - |
| DQL18_RS03395 | 661672..662394 | + | 723 | WP_111722498.1 | helix-turn-helix domain-containing protein | - |
| DQL18_RS03400 | 662391..663017 | + | 627 | WP_042602862.1 | replication P | - |
| DQL18_RS03405 | 663014..663604 | + | 591 | WP_111722500.1 | adenine methyltransferase | - |
| DQL18_RS03410 | 663609..664118 | + | 510 | WP_005692600.1 | DUF1367 family protein | - |
| DQL18_RS03415 | 664119..664547 | - | 429 | WP_105891871.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DQL18_RS03420 | 664578..664763 | - | 186 | WP_111722502.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DQL18_RS03425 | 664919..665506 | + | 588 | WP_111722504.1 | recombination protein NinG | - |
| DQL18_RS03430 | 665508..665873 | + | 366 | WP_111722506.1 | RNA polymerase subunit sigma-70 | - |
| DQL18_RS03435 | 665913..666431 | + | 519 | WP_111722508.1 | hypothetical protein | - |
| DQL18_RS03440 | 666542..667441 | + | 900 | WP_013525610.1 | hypothetical protein | - |
| DQL18_RS03450 | 667850..668362 | + | 513 | WP_111722510.1 | kinase | - |
| DQL18_RS03455 | 668541..668900 | + | 360 | WP_032826240.1 | phage holin, lambda family | - |
| DQL18_RS03460 | 668866..669468 | + | 603 | WP_006995063.1 | glycoside hydrolase family 19 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 642605..695358 | 52753 | |
| - | inside | Prophage | - | - | 647256..695358 | 48102 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6706.84 Da Isoelectric Point: 11.1595
>T292647 WP_111722502.1 NZ_LS483486:c664763-664578 [Haemophilus influenzae]
MRSSDLIKELKSAGCTFVRHGKGDHQIWQSPITGKTFPVPHPKQHVSIGTLRSIKKSAGLL
MRSSDLIKELKSAGCTFVRHGKGDHQIWQSPITGKTFPVPHPKQHVSIGTLRSIKKSAGLL
Download Length: 186 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 16398.34 Da Isoelectric Point: 4.3241
>AT292647 WP_105891871.1 NZ_LS483486:c664547-664119 [Haemophilus influenzae]
MLFTIGIETPTNENEAYGITVPALFTEEYSCFSAADTLEEIPTQATDAIHSILEIMFEDGIDINELQDKGYRHYQTQEDF
NYCDTWLLLDVDISAYQGKRHRINISLPEYLIKRIDSRVASNPIYKDRSHFLAVASQKELRQ
MLFTIGIETPTNENEAYGITVPALFTEEYSCFSAADTLEEIPTQATDAIHSILEIMFEDGIDINELQDKGYRHYQTQEDF
NYCDTWLLLDVDISAYQGKRHRINISLPEYLIKRIDSRVASNPIYKDRSHFLAVASQKELRQ
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|