Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 46502..47133 | Replicon | chromosome |
Accession | NZ_LS483486 | ||
Organism | Haemophilus influenzae strain NCTC12194 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DQL18_RS00235 | Protein ID | WP_105905411.1 |
Coordinates | 46735..47133 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q4QLV9 |
Locus tag | DQL18_RS00230 | Protein ID | WP_005648011.1 |
Coordinates | 46502..46735 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL18_RS00205 | 41982..43184 | - | 1203 | WP_011272308.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
DQL18_RS00210 | 43347..44012 | + | 666 | WP_013526173.1 | DNA repair protein RadC | - |
DQL18_RS00215 | 44226..44462 | + | 237 | WP_005542826.1 | 50S ribosomal protein L28 | - |
DQL18_RS00220 | 44474..44644 | + | 171 | WP_005613503.1 | 50S ribosomal protein L33 | - |
DQL18_RS00225 | 44991..46355 | + | 1365 | WP_005651563.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
DQL18_RS00230 | 46502..46735 | + | 234 | WP_005648011.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
DQL18_RS00235 | 46735..47133 | + | 399 | WP_105905411.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
DQL18_RS00240 | 47153..48688 | + | 1536 | WP_011272306.1 | L-2,4-diaminobutyrate decarboxylase | - |
DQL18_RS00245 | 48920..49735 | + | 816 | WP_011272305.1 | DNA-formamidopyrimidine glycosylase | - |
DQL18_RS00250 | 49809..50831 | - | 1023 | WP_005693292.1 | outer membrane-stress sensor serine endopeptidase DegS | - |
DQL18_RS00255 | 50832..51950 | - | 1119 | WP_011272304.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15087.40 Da Isoelectric Point: 8.0514
>T292642 WP_105905411.1 NZ_LS483486:46735-47133 [Haemophilus influenzae]
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILASNNLREFERVIALRTENWV
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILASNNLREFERVIALRTENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|