Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2225274..2225803 | Replicon | chromosome |
Accession | NZ_LS483484 | ||
Organism | Staphylococcus aureus strain NCTC13277 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q6GF05 |
Locus tag | DQL77_RS11465 | Protein ID | WP_000621176.1 |
Coordinates | 2225274..2225636 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DQL77_RS11470 | Protein ID | WP_000948331.1 |
Coordinates | 2225633..2225803 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL77_RS11440 | 2222253..2223023 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
DQL77_RS11445 | 2222998..2223477 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DQL77_RS11450 | 2223479..2223805 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DQL77_RS11455 | 2223924..2224925 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL77_RS11465 | 2225274..2225636 | - | 363 | WP_000621176.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL77_RS11470 | 2225633..2225803 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DQL77_RS11475 | 2225888..2227036 | - | 1149 | WP_001281140.1 | alanine racemase | - |
DQL77_RS11480 | 2227102..2227461 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DQL77_RS11485 | 2227465..2227956 | - | 492 | WP_001286801.1 | PH domain-containing protein | - |
DQL77_RS11490 | 2227949..2229526 | - | 1578 | WP_001294646.1 | PH domain-containing protein | - |
DQL77_RS11495 | 2229519..2229998 | - | 480 | WP_001287082.1 | hypothetical protein | - |
DQL77_RS11500 | 2230207..2230767 | - | 561 | WP_001092414.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T292634 WP_000621176.1 NZ_LS483484:c2225636-2225274 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A168PYX0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0VRZ1 |