Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2225274..2225803 Replicon chromosome
Accession NZ_LS483484
Organism Staphylococcus aureus strain NCTC13277

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag DQL77_RS11465 Protein ID WP_000621176.1
Coordinates 2225274..2225636 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag DQL77_RS11470 Protein ID WP_000948331.1
Coordinates 2225633..2225803 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL77_RS11440 2222253..2223023 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
DQL77_RS11445 2222998..2223477 - 480 WP_001190825.1 anti-sigma B factor RsbW -
DQL77_RS11450 2223479..2223805 - 327 WP_001052491.1 anti-sigma factor antagonist -
DQL77_RS11455 2223924..2224925 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
DQL77_RS11465 2225274..2225636 - 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
DQL77_RS11470 2225633..2225803 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
DQL77_RS11475 2225888..2227036 - 1149 WP_001281140.1 alanine racemase -
DQL77_RS11480 2227102..2227461 - 360 WP_000581197.1 holo-ACP synthase -
DQL77_RS11485 2227465..2227956 - 492 WP_001286801.1 PH domain-containing protein -
DQL77_RS11490 2227949..2229526 - 1578 WP_001294646.1 PH domain-containing protein -
DQL77_RS11495 2229519..2229998 - 480 WP_001287082.1 hypothetical protein -
DQL77_RS11500 2230207..2230767 - 561 WP_001092414.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T292634 WP_000621176.1 NZ_LS483484:c2225636-2225274 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT292634 WP_000948331.1 NZ_LS483484:c2225803-2225633 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References