Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1122160..1122969 | Replicon | chromosome |
Accession | NZ_LS483482 | ||
Organism | Staphylococcus lugdunensis strain NCTC12217 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | DQL46_RS05365 | Protein ID | WP_002458758.1 |
Coordinates | 1122799..1122969 (+) | Length | 57 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | DQL46_RS05360 | Protein ID | WP_070648686.1 |
Coordinates | 1122160..1122759 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL46_RS05340 | 1117748..1119205 | + | 1458 | WP_002477974.1 | ABC transporter substrate-binding protein/permease | - |
DQL46_RS05345 | 1119198..1119922 | + | 725 | Protein_1012 | amino acid ABC transporter ATP-binding protein | - |
DQL46_RS05350 | 1120380..1121522 | + | 1143 | WP_103284502.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DQL46_RS05355 | 1121524..1121994 | + | 471 | WP_002458756.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DQL46_RS05360 | 1122160..1122759 | + | 600 | WP_070648686.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DQL46_RS05365 | 1122799..1122969 | + | 171 | WP_002458758.1 | hypothetical protein | Toxin |
DQL46_RS05370 | 1123143..1123538 | + | 396 | WP_002458759.1 | hypothetical protein | - |
DQL46_RS05375 | 1123666..1125051 | + | 1386 | WP_070648688.1 | class II fumarate hydratase | - |
DQL46_RS05380 | 1125116..1125952 | - | 837 | WP_002477978.1 | RluA family pseudouridine synthase | - |
DQL46_RS05385 | 1126120..1127232 | + | 1113 | WP_060795476.1 | GAF domain-containing sensor histidine kinase | - |
DQL46_RS05390 | 1127254..1127877 | + | 624 | WP_002477980.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 57 a.a. Molecular weight: 6565.10 Da Isoelectric Point: 4.6723
>T292623 WP_002458758.1 NZ_LS483482:1122799-1122969 [Staphylococcus lugdunensis]
MSKEKKSRLNYHEEENAMVENLEDLKELGKEMEHISEKNDEEKVNQSHDTSKSSNS
MSKEKKSRLNYHEEENAMVENLEDLKELGKEMEHISEKNDEEKVNQSHDTSKSSNS
Download Length: 171 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22637.55 Da Isoelectric Point: 4.9539
>AT292623 WP_070648686.1 NZ_LS483482:1122160-1122759 [Staphylococcus lugdunensis]
MAMNFKVFENKDQVAEYSADIIRKQFNNNPTTIAGFHLNKEASPVLDMLKKNVDQHAVDFSQINILDYDQNQEYFKALGV
PESQIYPISYDQDAEAFISDKIKTKDNKGKLMLQVASIDDQGNLNISLRQGLLNAREIILVITGHNKKEVVEKLYNENGK
SNFEPADLKAHRMVTVILDEAAAEGLPEDVRHYFTDRFA
MAMNFKVFENKDQVAEYSADIIRKQFNNNPTTIAGFHLNKEASPVLDMLKKNVDQHAVDFSQINILDYDQNQEYFKALGV
PESQIYPISYDQDAEAFISDKIKTKDNKGKLMLQVASIDDQGNLNISLRQGLLNAREIILVITGHNKKEVVEKLYNENGK
SNFEPADLKAHRMVTVILDEAAAEGLPEDVRHYFTDRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|