Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-DUF971
Location 1403114..1403703 Replicon chromosome
Accession NZ_LS483480
Organism Haemophilus influenzae strain NCTC13377

Toxin (Protein)


Gene name PumA Uniprot ID A0A852PKG5
Locus tag DQL19_RS07285 Protein ID WP_005662099.1
Coordinates 1403404..1403703 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag DQL19_RS07280 Protein ID WP_015702300.1
Coordinates 1403114..1403407 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL19_RS07225 1398378..1398674 + 297 WP_015702309.1 hypothetical protein -
DQL19_RS07230 1398733..1398894 - 162 Protein_1343 helix-turn-helix domain-containing protein -
DQL19_RS07235 1398891..1399196 - 306 Protein_1344 phage antirepressor KilAC domain-containing protein -
DQL19_RS07240 1399188..1399856 + 669 WP_041175131.1 phage regulatory protein/antirepressor Ant -
DQL19_RS07245 1399853..1400575 + 723 WP_077643894.1 helix-turn-helix domain-containing protein -
DQL19_RS07250 1400572..1401198 + 627 WP_015702304.1 replication P -
DQL19_RS07255 1401195..1401419 + 225 WP_015702303.1 hypothetical protein -
DQL19_RS07260 1401456..1401872 + 417 WP_005662137.1 recombination protein NinB -
DQL19_RS07265 1401952..1402155 + 204 WP_015701526.1 elongation factor Tu -
DQL19_RS07270 1402158..1402712 + 555 WP_077643895.1 recombination protein NinG -
DQL19_RS07275 1402714..1403082 + 369 WP_015702301.1 antitermination protein -
DQL19_RS07280 1403114..1403407 - 294 WP_015702300.1 putative addiction module antidote protein Antitoxin
DQL19_RS07285 1403404..1403703 - 300 WP_005662099.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQL19_RS07290 1404071..1404748 + 678 WP_015702298.1 hypothetical protein -
DQL19_RS09625 1404823..1404960 + 138 WP_015702297.1 hypothetical protein -
DQL19_RS07295 1405084..1405440 + 357 WP_005650535.1 phage holin, lambda family -
DQL19_RS07300 1405409..1406012 + 604 Protein_1358 glycoside hydrolase family 19 protein -
DQL19_RS07305 1406005..1406328 + 324 WP_041175082.1 DUF2570 family protein -
DQL19_RS07310 1406240..1406521 + 282 WP_041175081.1 hypothetical protein -
DQL19_RS07315 1406523..1406870 - 348 WP_015702293.1 helix-turn-helix domain-containing protein -
DQL19_RS07320 1406854..1407105 - 252 WP_015702292.1 type II toxin-antitoxin system RelE/ParE family toxin -
DQL19_RS07325 1407182..1407694 + 513 WP_011272619.1 terminase small subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1387490..1430293 42803


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-86)

Antitoxin

Cro/C1-type helix-turn-helix domain

(46-89)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11197.10 Da        Isoelectric Point: 10.4328

>T292619 WP_005662099.1 NZ_LS483480:c1403703-1403404 [Haemophilus influenzae]
MTIQIKTTLTFDSWLSKLKNLRAKAKINARIKRLQFGNFGDIKSVNDGIFELRIDEGQGYRIYLKNQNGVLVILLCGGDK
STQEKDIKQAKLLAQELGL

Download         Length: 300 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10917.44 Da        Isoelectric Point: 4.4488

>AT292619 WP_015702300.1 NZ_LS483480:c1403407-1403114 [Haemophilus influenzae]
MTEQLKDFDVAEHLISEEEIQLYLNEILQEDNIELILSSLGDIARARNMSQIARDAGISREGLYKALSGTGNPTFATVMK
VMKALNLQFQVQQSRFA

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A852PKG5

Antitoxin

Source ID Structure

References