Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-DUF971 |
| Location | 1403114..1403703 | Replicon | chromosome |
| Accession | NZ_LS483480 | ||
| Organism | Haemophilus influenzae strain NCTC13377 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A852PKG5 |
| Locus tag | DQL19_RS07285 | Protein ID | WP_005662099.1 |
| Coordinates | 1403404..1403703 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | DQL19_RS07280 | Protein ID | WP_015702300.1 |
| Coordinates | 1403114..1403407 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL19_RS07225 | 1398378..1398674 | + | 297 | WP_015702309.1 | hypothetical protein | - |
| DQL19_RS07230 | 1398733..1398894 | - | 162 | Protein_1343 | helix-turn-helix domain-containing protein | - |
| DQL19_RS07235 | 1398891..1399196 | - | 306 | Protein_1344 | phage antirepressor KilAC domain-containing protein | - |
| DQL19_RS07240 | 1399188..1399856 | + | 669 | WP_041175131.1 | phage regulatory protein/antirepressor Ant | - |
| DQL19_RS07245 | 1399853..1400575 | + | 723 | WP_077643894.1 | helix-turn-helix domain-containing protein | - |
| DQL19_RS07250 | 1400572..1401198 | + | 627 | WP_015702304.1 | replication P | - |
| DQL19_RS07255 | 1401195..1401419 | + | 225 | WP_015702303.1 | hypothetical protein | - |
| DQL19_RS07260 | 1401456..1401872 | + | 417 | WP_005662137.1 | recombination protein NinB | - |
| DQL19_RS07265 | 1401952..1402155 | + | 204 | WP_015701526.1 | elongation factor Tu | - |
| DQL19_RS07270 | 1402158..1402712 | + | 555 | WP_077643895.1 | recombination protein NinG | - |
| DQL19_RS07275 | 1402714..1403082 | + | 369 | WP_015702301.1 | antitermination protein | - |
| DQL19_RS07280 | 1403114..1403407 | - | 294 | WP_015702300.1 | putative addiction module antidote protein | Antitoxin |
| DQL19_RS07285 | 1403404..1403703 | - | 300 | WP_005662099.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL19_RS07290 | 1404071..1404748 | + | 678 | WP_015702298.1 | hypothetical protein | - |
| DQL19_RS09625 | 1404823..1404960 | + | 138 | WP_015702297.1 | hypothetical protein | - |
| DQL19_RS07295 | 1405084..1405440 | + | 357 | WP_005650535.1 | phage holin, lambda family | - |
| DQL19_RS07300 | 1405409..1406012 | + | 604 | Protein_1358 | glycoside hydrolase family 19 protein | - |
| DQL19_RS07305 | 1406005..1406328 | + | 324 | WP_041175082.1 | DUF2570 family protein | - |
| DQL19_RS07310 | 1406240..1406521 | + | 282 | WP_041175081.1 | hypothetical protein | - |
| DQL19_RS07315 | 1406523..1406870 | - | 348 | WP_015702293.1 | helix-turn-helix domain-containing protein | - |
| DQL19_RS07320 | 1406854..1407105 | - | 252 | WP_015702292.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DQL19_RS07325 | 1407182..1407694 | + | 513 | WP_011272619.1 | terminase small subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1387490..1430293 | 42803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11197.10 Da Isoelectric Point: 10.4328
>T292619 WP_005662099.1 NZ_LS483480:c1403703-1403404 [Haemophilus influenzae]
MTIQIKTTLTFDSWLSKLKNLRAKAKINARIKRLQFGNFGDIKSVNDGIFELRIDEGQGYRIYLKNQNGVLVILLCGGDK
STQEKDIKQAKLLAQELGL
MTIQIKTTLTFDSWLSKLKNLRAKAKINARIKRLQFGNFGDIKSVNDGIFELRIDEGQGYRIYLKNQNGVLVILLCGGDK
STQEKDIKQAKLLAQELGL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|