Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
| Location | 358344..358992 | Replicon | chromosome |
| Accession | NZ_LS483480 | ||
| Organism | Haemophilus influenzae strain NCTC13377 | ||
Toxin (Protein)
| Gene name | toxT | Uniprot ID | - |
| Locus tag | DQL19_RS01800 | Protein ID | WP_077643740.1 |
| Coordinates | 358344..358703 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | DQL19_RS01805 | Protein ID | WP_005650837.1 |
| Coordinates | 358696..358992 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL19_RS01795 | 355126..358074 | + | 2949 | WP_111742157.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| DQL19_RS01800 | 358344..358703 | + | 360 | WP_077643740.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL19_RS01805 | 358696..358992 | + | 297 | WP_005650837.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| DQL19_RS01810 | 359149..361065 | + | 1917 | WP_077643739.1 | ABC transporter ATP-binding protein | - |
| DQL19_RS01815 | 361075..361611 | + | 537 | WP_077643738.1 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| DQL19_RS01820 | 361627..362178 | + | 552 | WP_077643737.1 | Sua5/YciO/YrdC/YwlC family protein | - |
| DQL19_RS01825 | 362182..362988 | + | 807 | WP_077643736.1 | shikimate dehydrogenase | - |
| DQL19_RS01830 | 363202..363765 | + | 564 | WP_077643735.1 | DNA-3-methyladenine glycosylase I | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 14287.65 Da Isoelectric Point: 10.1408
>T292617 WP_077643740.1 NZ_LS483480:358344-358703 [Haemophilus influenzae]
MYEILLYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
MYEILLYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|