Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 300005..300609 | Replicon | chromosome |
| Accession | NZ_LS483480 | ||
| Organism | Haemophilus influenzae strain NCTC13377 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2S9RBL9 |
| Locus tag | DQL19_RS01520 | Protein ID | WP_050948779.1 |
| Coordinates | 300005..300313 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q4QMK8 |
| Locus tag | DQL19_RS01525 | Protein ID | WP_005692346.1 |
| Coordinates | 300313..300609 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL19_RS01505 | 295094..296392 | - | 1299 | WP_006995277.1 | trigger factor | - |
| DQL19_RS01515 | 296760..299948 | + | 3189 | WP_172451694.1 | TonB-dependent receptor | - |
| DQL19_RS01520 | 300005..300313 | - | 309 | WP_050948779.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| DQL19_RS01525 | 300313..300609 | - | 297 | WP_005692346.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| DQL19_RS01530 | 300729..301583 | - | 855 | WP_070828147.1 | DUF3298 domain-containing protein | - |
| DQL19_RS01535 | 301602..303461 | - | 1860 | WP_077643973.1 | selenocysteine-specific translation elongation factor | - |
| DQL19_RS01540 | 303458..304843 | - | 1386 | WP_077643972.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11949.72 Da Isoelectric Point: 7.8657
>T292615 WP_050948779.1 NZ_LS483480:c300313-300005 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IRDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IRDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S9RBL9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q4QMK8 |