Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 48035..48666 | Replicon | chromosome |
| Accession | NZ_LS483480 | ||
| Organism | Haemophilus influenzae strain NCTC13377 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q4QLW0 |
| Locus tag | DQL19_RS00245 | Protein ID | WP_005651560.1 |
| Coordinates | 48268..48666 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2X4XKC3 |
| Locus tag | DQL19_RS00240 | Protein ID | WP_015701961.1 |
| Coordinates | 48035..48268 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL19_RS00215 | 43515..44717 | - | 1203 | WP_015701964.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
| DQL19_RS00220 | 44880..45545 | + | 666 | WP_013527272.1 | DNA repair protein RadC | - |
| DQL19_RS00225 | 45759..45995 | + | 237 | WP_005542826.1 | 50S ribosomal protein L28 | - |
| DQL19_RS00230 | 46007..46177 | + | 171 | WP_005613503.1 | 50S ribosomal protein L33 | - |
| DQL19_RS00235 | 46524..47888 | + | 1365 | WP_015701962.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
| DQL19_RS00240 | 48035..48268 | + | 234 | WP_015701961.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
| DQL19_RS00245 | 48268..48666 | + | 399 | WP_005651560.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| DQL19_RS00250 | 48686..50221 | + | 1536 | WP_015701960.1 | L-2,4-diaminobutyrate decarboxylase | - |
| DQL19_RS00255 | 50452..51267 | + | 816 | WP_015701959.1 | DNA-formamidopyrimidine glycosylase | - |
| DQL19_RS00260 | 51341..52363 | - | 1023 | WP_015701958.1 | outer membrane-stress sensor serine endopeptidase DegS | - |
| DQL19_RS00265 | 52364..53482 | - | 1119 | WP_015701957.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15115.46 Da Isoelectric Point: 8.0514
>T292613 WP_005651560.1 NZ_LS483480:48268-48666 [Haemophilus influenzae]
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q4QLW0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X4XKC3 |