Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 735908..736544 | Replicon | chromosome |
Accession | NZ_LS483476 | ||
Organism | Lederbergia lentus strain NCTC4824 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2X4W2Y5 |
Locus tag | DQN84_RS03605 | Protein ID | WP_066146703.1 |
Coordinates | 736194..736544 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A2X4VQT8 |
Locus tag | DQN84_RS03600 | Protein ID | WP_066146706.1 |
Coordinates | 735908..736189 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN84_RS03580 | 732040..732651 | - | 612 | WP_066146717.1 | rhomboid family intramembrane serine protease | - |
DQN84_RS03585 | 732771..733124 | + | 354 | WP_066146714.1 | holo-ACP synthase | - |
DQN84_RS03590 | 733387..734403 | + | 1017 | WP_066146713.1 | outer membrane lipoprotein carrier protein LolA | - |
DQN84_RS03595 | 734561..735724 | + | 1164 | WP_066146709.1 | alanine racemase | - |
DQN84_RS03600 | 735908..736189 | + | 282 | WP_066146706.1 | antitoxin endoai | Antitoxin |
DQN84_RS03605 | 736194..736544 | + | 351 | WP_066146703.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQN84_RS03610 | 736711..737544 | + | 834 | WP_066146700.1 | STAS domain-containing protein | - |
DQN84_RS03615 | 737547..737903 | + | 357 | WP_066146760.1 | STAS domain-containing protein | - |
DQN84_RS03620 | 737907..738308 | + | 402 | WP_066146695.1 | anti-sigma regulatory factor | - |
DQN84_RS03625 | 738323..739330 | + | 1008 | WP_066146692.1 | PP2C family protein-serine/threonine phosphatase | - |
DQN84_RS03630 | 739402..739731 | + | 330 | WP_066146690.1 | STAS domain-containing protein | - |
DQN84_RS03635 | 739731..740204 | + | 474 | WP_066146758.1 | anti-sigma B factor RsbW | - |
DQN84_RS03640 | 740182..740976 | + | 795 | WP_066146688.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13009.03 Da Isoelectric Point: 5.7347
>T292612 WP_066146703.1 NZ_LS483476:736194-736544 [Lederbergia lentus]
MAVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDSKRYSFERDSVLLLEQV
RTIDKQRLTDKITHLDEEMMKKVDEALQISLGLIDF
MAVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDSKRYSFERDSVLLLEQV
RTIDKQRLTDKITHLDEEMMKKVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X4W2Y5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X4VQT8 |