Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 462430..463004 | Replicon | chromosome |
Accession | NZ_LS483473 | ||
Organism | Pasteurella multocida strain NCTC10382 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | DQL67_RS02190 | Protein ID | WP_061406134.1 |
Coordinates | 462430..462714 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | DQL67_RS02195 | Protein ID | WP_061406133.1 |
Coordinates | 462711..463004 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL67_RS02170 | 458223..459812 | - | 1590 | WP_081106270.1 | AAA family ATPase | - |
DQL67_RS02175 | 460097..460648 | - | 552 | WP_196766247.1 | NERD domain-containing protein | - |
DQL67_RS02180 | 460792..461151 | + | 360 | WP_095261631.1 | DUF3418 domain-containing protein | - |
DQL67_RS02190 | 462430..462714 | + | 285 | WP_061406134.1 | hypothetical protein | Toxin |
DQL67_RS02195 | 462711..463004 | + | 294 | WP_061406133.1 | putative addiction module antidote protein | Antitoxin |
DQL67_RS02200 | 463407..464084 | - | 678 | WP_005726756.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
DQL67_RS02205 | 464102..464569 | - | 468 | WP_005726755.1 | PTS sugar transporter subunit IIA | - |
DQL67_RS02210 | 464614..466404 | - | 1791 | WP_005726754.1 | PTS ascorbate-specific subunit IIBC | - |
DQL67_RS02215 | 466754..467845 | + | 1092 | WP_005751571.1 | L-ascorbate 6-phosphate lactonase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10667.40 Da Isoelectric Point: 10.2297
>T292611 WP_061406134.1 NZ_LS483473:462430-462714 [Pasteurella multocida]
VGRLKEVKILSAKSAVLARINKAMNGNFGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLKEVKILSAKSAVLARINKAMNGNFGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|