Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 1628137..1628783 | Replicon | chromosome |
| Accession | NZ_LS483470 | ||
| Organism | Leminorella richardii strain NCTC12151 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | DQM29_RS07575 | Protein ID | WP_111740118.1 |
| Coordinates | 1628137..1628412 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | DQM29_RS07580 | Protein ID | WP_111742031.1 |
| Coordinates | 1628415..1628783 (+) | Length | 123 a.a. |
Genomic Context
Location: 1623721..1625077 (1357 bp)
Type: Others
Protein ID: Protein_1462
Type: Others
Protein ID: Protein_1462
Location: 1625080..1625876 (797 bp)
Type: Others
Protein ID: Protein_1463
Type: Others
Protein ID: Protein_1463
Location: 1625906..1626763 (858 bp)
Type: Others
Protein ID: WP_111740115.1
Type: Others
Protein ID: WP_111740115.1
Location: 1626945..1627649 (705 bp)
Type: Others
Protein ID: WP_111740116.1
Type: Others
Protein ID: WP_111740116.1
Location: 1627661..1627975 (315 bp)
Type: Others
Protein ID: WP_111740117.1
Type: Others
Protein ID: WP_111740117.1
Location: 1628137..1628412 (276 bp)
Type: Toxin
Protein ID: WP_111740118.1
Type: Toxin
Protein ID: WP_111740118.1
Location: 1628415..1628783 (369 bp)
Type: Antitoxin
Protein ID: WP_111742031.1
Type: Antitoxin
Protein ID: WP_111742031.1
Location: 1628882..1629931 (1050 bp)
Type: Others
Protein ID: WP_111740119.1
Type: Others
Protein ID: WP_111740119.1
Location: 1630266..1630886 (621 bp)
Type: Others
Protein ID: WP_111740120.1
Type: Others
Protein ID: WP_111740120.1
Location: 1630880..1631656 (777 bp)
Type: Others
Protein ID: WP_111740121.1
Type: Others
Protein ID: WP_111740121.1
Location: 1631638..1632375 (738 bp)
Type: Others
Protein ID: WP_111740122.1
Type: Others
Protein ID: WP_111740122.1
Location: 1632382..1632969 (588 bp)
Type: Others
Protein ID: WP_111740123.1
Type: Others
Protein ID: WP_111740123.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM29_RS07550 | 1623721..1625077 | + | 1357 | Protein_1462 | MFS transporter | - |
| DQM29_RS07555 | 1625080..1625876 | + | 797 | Protein_1463 | sugar phosphate isomerase/epimerase | - |
| DQM29_RS07560 | 1625906..1626763 | + | 858 | WP_111740115.1 | oxidoreductase | - |
| DQM29_RS07565 | 1626945..1627649 | + | 705 | WP_111740116.1 | transcriptional regulator NanR | - |
| DQM29_RS07570 | 1627661..1627975 | + | 315 | WP_111740117.1 | hypothetical protein | - |
| DQM29_RS07575 | 1628137..1628412 | + | 276 | WP_111740118.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DQM29_RS07580 | 1628415..1628783 | + | 369 | WP_111742031.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DQM29_RS07585 | 1628882..1629931 | - | 1050 | WP_111740119.1 | DUF695 domain-containing protein | - |
| DQM29_RS07590 | 1630266..1630886 | - | 621 | WP_111740120.1 | bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE | - |
| DQM29_RS07595 | 1630880..1631656 | - | 777 | WP_111740121.1 | imidazole glycerol phosphate synthase subunit HisF | - |
| DQM29_RS07600 | 1631638..1632375 | - | 738 | WP_111740122.1 | 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase | - |
| DQM29_RS07605 | 1632382..1632969 | - | 588 | WP_111740123.1 | imidazole glycerol phosphate synthase subunit HisH | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 9942.61 Da Isoelectric Point: 10.1492
>T292605 WP_111740118.1 NZ_LS483470:1628137-1628412 [Leminorella richardii]
MQEKVLLLRKKQYSTLSQLFKIPALAGIKWKDIESLVIALGGEVQEGNGSRVKFFLAGSIAHFHRPHPSPDTDKGAVVSV
GDWLMSLGVTP
MQEKVLLLRKKQYSTLSQLFKIPALAGIKWKDIESLVIALGGEVQEGNGSRVKFFLAGSIAHFHRPHPSPDTDKGAVVSV
GDWLMSLGVTP
Download Length: 276 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13736.62 Da Isoelectric Point: 5.6859
>AT292605 WP_111742031.1 NZ_LS483470:1628415-1628783 [Leminorella richardii]
MKKQPDINTLNTMVVAGQPAIISFVPELGAFRGRFLGLSGYCDFVADSISALKHEGEISLREYLEDCKEHGIEPYARKEK
QRTFTLRYPESFGEQLEHAAAASEVSLNSFIVDVLKERLSRQ
MKKQPDINTLNTMVVAGQPAIISFVPELGAFRGRFLGLSGYCDFVADSISALKHEGEISLREYLEDCKEHGIEPYARKEK
QRTFTLRYPESFGEQLEHAAAASEVSLNSFIVDVLKERLSRQ
Download Length: 369 bp