Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1394109..1394699 | Replicon | chromosome |
Accession | NZ_LS483470 | ||
Organism | Leminorella richardii strain NCTC12151 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | DQM29_RS06580 | Protein ID | WP_111739950.1 |
Coordinates | 1394367..1394699 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | DQM29_RS06575 | Protein ID | WP_111739949.1 |
Coordinates | 1394109..1394366 (+) | Length | 86 a.a. |
Genomic Context
Location: 1390250..1390681 (432 bp)
Type: Others
Protein ID: WP_111739944.1
Type: Others
Protein ID: WP_111739944.1
Location: 1390776..1391447 (672 bp)
Type: Others
Protein ID: WP_111739945.1
Type: Others
Protein ID: WP_111739945.1
Location: 1391533..1392696 (1164 bp)
Type: Others
Protein ID: WP_111739946.1
Type: Others
Protein ID: WP_111739946.1
Location: 1392979..1393332 (354 bp)
Type: Others
Protein ID: WP_111739947.1
Type: Others
Protein ID: WP_111739947.1
Location: 1393337..1393639 (303 bp)
Type: Others
Protein ID: WP_111739948.1
Type: Others
Protein ID: WP_111739948.1
Location: 1394109..1394366 (258 bp)
Type: Antitoxin
Protein ID: WP_111739949.1
Type: Antitoxin
Protein ID: WP_111739949.1
Location: 1394367..1394699 (333 bp)
Type: Toxin
Protein ID: WP_111739950.1
Type: Toxin
Protein ID: WP_111739950.1
Location: 1395208..1396419 (1212 bp)
Type: Others
Protein ID: WP_111739951.1
Type: Others
Protein ID: WP_111739951.1
Location: 1396436..1398118 (1683 bp)
Type: Others
Protein ID: WP_111739952.1
Type: Others
Protein ID: WP_111739952.1
Location: 1398335..1399207 (873 bp)
Type: Others
Protein ID: WP_111739953.1
Type: Others
Protein ID: WP_111739953.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM29_RS06550 | 1390250..1390681 | + | 432 | WP_111739944.1 | carboxymuconolactone decarboxylase family protein | - |
DQM29_RS06555 | 1390776..1391447 | + | 672 | WP_111739945.1 | MmcQ/YjbR family DNA-binding protein | - |
DQM29_RS06560 | 1391533..1392696 | + | 1164 | WP_111739946.1 | winged helix-turn-helix domain-containing protein | - |
DQM29_RS06565 | 1392979..1393332 | + | 354 | WP_111739947.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DQM29_RS06570 | 1393337..1393639 | + | 303 | WP_111739948.1 | XRE family transcriptional regulator | - |
DQM29_RS06575 | 1394109..1394366 | + | 258 | WP_111739949.1 | antitoxin | Antitoxin |
DQM29_RS06580 | 1394367..1394699 | + | 333 | WP_111739950.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQM29_RS06585 | 1395208..1396419 | + | 1212 | WP_111739951.1 | hypothetical protein | - |
DQM29_RS06590 | 1396436..1398118 | + | 1683 | WP_111739952.1 | ATP-binding protein | - |
DQM29_RS06595 | 1398335..1399207 | - | 873 | WP_111739953.1 | integrase domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11785.55 Da Isoelectric Point: 10.7301
>T292604 WP_111739950.1 NZ_LS483470:1394367-1394699 [Leminorella richardii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNNLTRLPVVVPVTSGGNFARTAGFTVSLDGSGTKTTGVIRCDQPRTI
DIGARNGKRLERIPDSITNEVLARLGAILF
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNNLTRLPVVVPVTSGGNFARTAGFTVSLDGSGTKTTGVIRCDQPRTI
DIGARNGKRLERIPDSITNEVLARLGAILF
Download Length: 333 bp