Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1042050..1042585 | Replicon | chromosome |
| Accession | NZ_LS483470 | ||
| Organism | Leminorella richardii strain NCTC12151 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | DQM29_RS04925 | Protein ID | WP_111739580.1 |
| Coordinates | 1042298..1042585 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | DQM29_RS04920 | Protein ID | WP_111739579.1 |
| Coordinates | 1042050..1042301 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM29_RS04895 | 1037225..1038247 | + | 1023 | WP_170126490.1 | thiosulfate ABC transporter substrate-binding protein CysP | - |
| DQM29_RS04900 | 1038250..1039083 | + | 834 | WP_111741998.1 | sulfate/thiosulfate ABC transporter permease CysT | - |
| DQM29_RS04905 | 1039083..1039958 | + | 876 | WP_111739576.1 | sulfate/thiosulfate ABC transporter permease CysW | - |
| DQM29_RS04910 | 1039948..1041042 | + | 1095 | WP_111739577.1 | sulfate/thiosulfate ABC transporter ATP-binding protein CysA | - |
| DQM29_RS04915 | 1041071..1041958 | + | 888 | WP_111739578.1 | cysteine synthase CysM | - |
| DQM29_RS04920 | 1042050..1042301 | + | 252 | WP_111739579.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DQM29_RS04925 | 1042298..1042585 | + | 288 | WP_111739580.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM29_RS04930 | 1042714..1044678 | - | 1965 | WP_111739581.1 | MacB family efflux pump subunit | - |
| DQM29_RS04935 | 1044683..1045873 | - | 1191 | WP_111739582.1 | efflux RND transporter periplasmic adaptor subunit | - |
| DQM29_RS04940 | 1046089..1046765 | + | 677 | Protein_966 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11055.07 Da Isoelectric Point: 10.4228
>T292601 WP_111739580.1 NZ_LS483470:1042298-1042585 [Leminorella richardii]
MSYAVKFRRDALKEWQKLDKAIQQQFAKKLKKCCEEPHLPAARLSGMPDCYKIKLRSSGFRLVYQVINDELLVVVVAVGK
RERSGVYHLASERMR
MSYAVKFRRDALKEWQKLDKAIQQQFAKKLKKCCEEPHLPAARLSGMPDCYKIKLRSSGFRLVYQVINDELLVVVVAVGK
RERSGVYHLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|