Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | sanaTA/AbiEii-DUF6088 |
Location | 837207..838545 | Replicon | chromosome |
Accession | NZ_LS483470 | ||
Organism | Leminorella richardii strain NCTC12151 |
Toxin (Protein)
Gene name | sanaT | Uniprot ID | - |
Locus tag | DQM29_RS03895 | Protein ID | WP_111739402.1 |
Coordinates | 837207..838157 (-) | Length | 317 a.a. |
Antitoxin (Protein)
Gene name | sanaA | Uniprot ID | - |
Locus tag | DQM29_RS03900 | Protein ID | WP_111739403.1 |
Coordinates | 838150..838545 (-) | Length | 132 a.a. |
Genomic Context
Location: 833230..833685 (456 bp)
Type: Others
Protein ID: WP_111739399.1
Type: Others
Protein ID: WP_111739399.1
Location: 841180..842067 (888 bp)
Type: Others
Protein ID: WP_111739406.1
Type: Others
Protein ID: WP_111739406.1
Location: 842122..842985 (864 bp)
Type: Others
Protein ID: WP_111739407.1
Type: Others
Protein ID: WP_111739407.1
Location: 833830..835047 (1218 bp)
Type: Others
Protein ID: WP_170126485.1
Type: Others
Protein ID: WP_170126485.1
Location: 835239..835904 (666 bp)
Type: Others
Protein ID: WP_111739401.1
Type: Others
Protein ID: WP_111739401.1
Location: 837207..838157 (951 bp)
Type: Toxin
Protein ID: WP_111739402.1
Type: Toxin
Protein ID: WP_111739402.1
Location: 838150..838545 (396 bp)
Type: Antitoxin
Protein ID: WP_111739403.1
Type: Antitoxin
Protein ID: WP_111739403.1
Location: 838616..838848 (233 bp)
Type: Others
Protein ID: Protein_763
Type: Others
Protein ID: Protein_763
Location: 839245..840036 (792 bp)
Type: Others
Protein ID: WP_111739404.1
Type: Others
Protein ID: WP_111739404.1
Location: 840085..840981 (897 bp)
Type: Others
Protein ID: WP_111739405.1
Type: Others
Protein ID: WP_111739405.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM29_RS03880 | 833230..833685 | + | 456 | WP_111739399.1 | GNAT family N-acetyltransferase | - |
DQM29_RS03885 | 833830..835047 | - | 1218 | WP_170126485.1 | sensor histidine kinase | - |
DQM29_RS03890 | 835239..835904 | - | 666 | WP_111739401.1 | response regulator | - |
DQM29_RS03895 | 837207..838157 | - | 951 | WP_111739402.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | Toxin |
DQM29_RS03900 | 838150..838545 | - | 396 | WP_111739403.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | Antitoxin |
DQM29_RS03905 | 838616..838848 | - | 233 | Protein_763 | DUF4942 domain-containing protein | - |
DQM29_RS03915 | 839245..840036 | - | 792 | WP_111739404.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM29_RS03920 | 840085..840981 | - | 897 | WP_111739405.1 | sugar kinase | - |
DQM29_RS03925 | 841180..842067 | + | 888 | WP_111739406.1 | sulfolactaldehyde 3-reductase | - |
DQM29_RS03930 | 842122..842985 | + | 864 | WP_111739407.1 | class II fructose-bisphosphate aldolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 317 a.a. Molecular weight: 35382.52 Da Isoelectric Point: 4.8402
>T292600 WP_111739402.1 NZ_LS483470:c838157-837207 [Leminorella richardii]
MDDLNVLFSDVADALGIESVAIVEKDHYIVELLRLLKQLTFDTHQLVFAGGTALAKSGVALNRMSEDVDIKLVPTAAFQA
LSRNQRKNTRKAIVLAISGAITTTDVFSFDDDYPKVTRDEYCYSDIPVRYPQRVAQAPCLRPFIRLELMESNLLEPPEPR
DIHSLITALTGKAPVVSAFPCATVANTQAEKLVAMLRRTAAIVRDVERFDDASLVRHIYDTYCIVEAGGVNMPLLTDYVQ
RTIEQDIQRYGSQYPQFCTSPIDELKMGLDELACNPLYQTRYQQFVAPMVYGARKASWDEAYASFRQIALAILNAD
MDDLNVLFSDVADALGIESVAIVEKDHYIVELLRLLKQLTFDTHQLVFAGGTALAKSGVALNRMSEDVDIKLVPTAAFQA
LSRNQRKNTRKAIVLAISGAITTTDVFSFDDDYPKVTRDEYCYSDIPVRYPQRVAQAPCLRPFIRLELMESNLLEPPEPR
DIHSLITALTGKAPVVSAFPCATVANTQAEKLVAMLRRTAAIVRDVERFDDASLVRHIYDTYCIVEAGGVNMPLLTDYVQ
RTIEQDIQRYGSQYPQFCTSPIDELKMGLDELACNPLYQTRYQQFVAPMVYGARKASWDEAYASFRQIALAILNAD
Download Length: 951 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14540.73 Da Isoelectric Point: 10.9903
>AT292600 WP_111739403.1 NZ_LS483470:c838545-838150 [Leminorella richardii]
MTIKARIQSRLKRSKRYVFTRDDFKDIAGYDQVGRVLRDLIKEGQLLKVGYGVYTKARQNSITGKVMPAAPGGSSAVIVE
TLERLKVRYRLAEETQAYNSGNSTQIPASPEIKTSSRFKRALSVGSSKLNG
MTIKARIQSRLKRSKRYVFTRDDFKDIAGYDQVGRVLRDLIKEGQLLKVGYGVYTKARQNSITGKVMPAAPGGSSAVIVE
TLERLKVRYRLAEETQAYNSGNSTQIPASPEIKTSSRFKRALSVGSSKLNG
Download Length: 396 bp