Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1707739..1708407 | Replicon | chromosome |
Accession | NZ_LS483451 | ||
Organism | Streptococcus pneumoniae strain 4041STDY6836166 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | I0T4C6 |
Locus tag | DQL01_RS09070 | Protein ID | WP_001132287.1 |
Coordinates | 1708228..1708407 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | DQL01_RS09065 | Protein ID | WP_000961810.1 |
Coordinates | 1707739..1708191 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL01_RS09040 | 1704063..1704806 | - | 744 | WP_061756712.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
DQL01_RS09045 | 1704808..1705758 | - | 951 | WP_023396409.1 | 50S ribosomal protein L11 methyltransferase | - |
DQL01_RS09050 | 1705896..1706330 | - | 435 | WP_061756711.1 | NUDIX hydrolase | - |
DQL01_RS09055 | 1706380..1706922 | - | 543 | WP_000891117.1 | hypothetical protein | - |
DQL01_RS09060 | 1706978..1707448 | - | 471 | WP_061756709.1 | DUF3013 family protein | - |
DQL01_RS09065 | 1707739..1708191 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DQL01_RS09070 | 1708228..1708407 | - | 180 | WP_001132287.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DQL01_RS09075 | 1708544..1708726 | - | 183 | WP_111702688.1 | hypothetical protein | - |
DQL01_RS09080 | 1708888..1710159 | + | 1272 | WP_111702689.1 | replication-associated recombination protein A | - |
DQL01_RS09090 | 1710704..1712023 | - | 1320 | WP_111702690.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6697.91 Da Isoelectric Point: 11.0174
>T292592 WP_001132287.1 NZ_LS483451:c1708407-1708228 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITIPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITIPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT292592 WP_000961810.1 NZ_LS483451:c1708191-1707739 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|