Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1699420..1700088 | Replicon | chromosome |
| Accession | NZ_LS483450 | ||
| Organism | Streptococcus pneumoniae strain 4041STDY6583227 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | I0T4C6 |
| Locus tag | DQL12_RS09095 | Protein ID | WP_001132287.1 |
| Coordinates | 1699909..1700088 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | DQL12_RS09090 | Protein ID | WP_000961810.1 |
| Coordinates | 1699420..1699872 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL12_RS09060 | 1694840..1695583 | - | 744 | WP_111695778.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| DQL12_RS09065 | 1695585..1696535 | - | 951 | WP_000451146.1 | 50S ribosomal protein L11 methyltransferase | - |
| DQL12_RS09070 | 1696673..1697146 | - | 474 | WP_000631889.1 | GNAT family N-acetyltransferase | - |
| DQL12_RS09075 | 1697143..1697571 | - | 429 | WP_050217633.1 | NUDIX hydrolase | - |
| DQL12_RS09080 | 1697552..1698640 | - | 1089 | WP_000719722.1 | M50 family metallopeptidase | - |
| DQL12_RS09085 | 1698659..1699129 | - | 471 | WP_000257097.1 | DUF3013 family protein | - |
| DQL12_RS09090 | 1699420..1699872 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DQL12_RS09095 | 1699909..1700088 | - | 180 | WP_001132287.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DQL12_RS09100 | 1700225..1700404 | - | 180 | WP_001048906.1 | hypothetical protein | - |
| DQL12_RS09110 | 1700569..1700784 | - | 216 | WP_075588414.1 | hypothetical protein | - |
| DQL12_RS09115 | 1701082..1702353 | + | 1272 | WP_001113213.1 | replication-associated recombination protein A | - |
| DQL12_RS09125 | 1702898..1704217 | - | 1320 | WP_000502540.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6697.91 Da Isoelectric Point: 11.0174
>T292588 WP_001132287.1 NZ_LS483450:c1700088-1699909 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITIPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITIPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT292588 WP_000961810.1 NZ_LS483450:c1699872-1699420 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|