Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1645681..1646349 | Replicon | chromosome |
Accession | NZ_LS483449 | ||
Organism | Streptococcus pneumoniae strain 4041STDY6836170 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | C1C927 |
Locus tag | DQK98_RS08595 | Protein ID | WP_001132282.1 |
Coordinates | 1646170..1646349 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | DQK98_RS08590 | Protein ID | WP_000961810.1 |
Coordinates | 1645681..1646133 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQK98_RS08560 | 1641101..1641844 | - | 744 | WP_001188200.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
DQK98_RS08565 | 1641846..1642796 | - | 951 | WP_024477875.1 | 50S ribosomal protein L11 methyltransferase | - |
DQK98_RS08570 | 1642934..1643407 | - | 474 | WP_000631889.1 | GNAT family N-acetyltransferase | - |
DQK98_RS08575 | 1643404..1643832 | - | 429 | WP_111688155.1 | NUDIX hydrolase | - |
DQK98_RS08580 | 1643813..1644901 | - | 1089 | WP_050308821.1 | M50 family metallopeptidase | - |
DQK98_RS08585 | 1644920..1645390 | - | 471 | WP_000257097.1 | DUF3013 family protein | - |
DQK98_RS08590 | 1645681..1646133 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DQK98_RS08595 | 1646170..1646349 | - | 180 | WP_001132282.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DQK98_RS08600 | 1646486..1646665 | - | 180 | WP_001048906.1 | hypothetical protein | - |
DQK98_RS08610 | 1646830..1647045 | - | 216 | WP_075329187.1 | hypothetical protein | - |
DQK98_RS08615 | 1647333..1648604 | + | 1272 | WP_001113225.1 | replication-associated recombination protein A | - |
DQK98_RS08625 | 1649024..1649737 | - | 714 | WP_172448788.1 | site-specific integrase | - |
DQK98_RS08630 | 1649887..1650150 | - | 264 | WP_050073086.1 | Arm DNA-binding domain-containing protein | - |
DQK98_RS08635 | 1650152..1650334 | - | 183 | WP_000655516.1 | DUF3173 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.95 Da Isoelectric Point: 11.0174
>T292582 WP_001132282.1 NZ_LS483449:c1646349-1646170 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT292582 WP_000961810.1 NZ_LS483449:c1646133-1645681 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E7SUI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0IC64 |