Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1673335..1673997 | Replicon | chromosome |
| Accession | NZ_LS483448 | ||
| Organism | Streptococcus pneumoniae strain 4041STDY6836167 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | DQK99_RS09050 | Protein ID | WP_000192224.1 |
| Coordinates | 1673824..1673997 (-) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | DQK99_RS09045 | Protein ID | WP_000961810.1 |
| Coordinates | 1673335..1673787 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQK99_RS09020 | 1669225..1669968 | - | 744 | WP_001188208.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| DQK99_RS09025 | 1669970..1670920 | - | 951 | WP_000451131.1 | 50S ribosomal protein L11 methyltransferase | - |
| DQK99_RS09030 | 1671058..1671486 | - | 429 | WP_000418156.1 | NUDIX hydrolase | - |
| DQK99_RS09035 | 1671467..1672555 | - | 1089 | WP_000719724.1 | M50 family metallopeptidase | - |
| DQK99_RS09040 | 1672574..1673044 | - | 471 | WP_000257097.1 | DUF3013 family protein | - |
| DQK99_RS09045 | 1673335..1673787 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DQK99_RS09050 | 1673824..1673997 | - | 174 | WP_000192224.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DQK99_RS09055 | 1674140..1674319 | - | 180 | WP_111703810.1 | hypothetical protein | - |
| DQK99_RS09065 | 1674484..1674723 | - | 240 | WP_000818079.1 | hypothetical protein | - |
| DQK99_RS09075 | 1674993..1676264 | + | 1272 | WP_001113216.1 | replication-associated recombination protein A | - |
| DQK99_RS09085 | 1676815..1678296 | - | 1482 | WP_001205280.1 | helix-turn-helix domain-containing protein | - |
| DQK99_RS09090 | 1678699..1678863 | + | 165 | WP_001809002.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1645216..1683467 | 38251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6386.51 Da Isoelectric Point: 10.8214
>T292579 WP_000192224.1 NZ_LS483448:c1673997-1673824 [Streptococcus pneumoniae]
MTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGELNKYTERGIGKQAGL
MTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGELNKYTERGIGKQAGL
Download Length: 174 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT292579 WP_000961810.1 NZ_LS483448:c1673787-1673335 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|