Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1563599..1564211 Replicon chromosome
Accession NZ_LS483442
Organism Streptococcus pyogenes strain NCTC8370

Toxin (Protein)


Gene name parE Uniprot ID J7M9F1
Locus tag DQN35_RS08090 Protein ID WP_010922665.1
Coordinates 1563876..1564211 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQN35_RS08085 Protein ID WP_002988079.1
Coordinates 1563599..1563886 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN35_RS08055 1558776..1559759 - 984 WP_002982755.1 tagatose-bisphosphate aldolase -
DQN35_RS08060 1559763..1560692 - 930 WP_010922663.1 tagatose-6-phosphate kinase -
DQN35_RS08065 1560740..1561255 - 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
DQN35_RS08070 1561290..1561718 - 429 WP_010922664.1 galactose-6-phosphate isomerase subunit LacA -
DQN35_RS08075 1562165..1562938 + 774 WP_002982738.1 DeoR/GlpR family DNA-binding transcription regulator -
DQN35_RS08085 1563599..1563886 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQN35_RS08090 1563876..1564211 + 336 WP_010922665.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQN35_RS09330 1564363..1564833 + 471 Protein_1486 integrase -
DQN35_RS08105 1564879..1565316 + 438 WP_111713473.1 site-specific integrase -
DQN35_RS08110 1565436..1565828 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQN35_RS08115 1565849..1566295 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQN35_RS08120 1566513..1566719 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
DQN35_RS08125 1566716..1567222 - 507 WP_002988070.1 hypothetical protein -
DQN35_RS08130 1567358..1568218 - 861 WP_002982687.1 DegV family protein -
DQN35_RS08135 1568315..1568833 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13185.99 Da        Isoelectric Point: 5.2144

>T292572 WP_010922665.1 NZ_LS483442:1563876-1564211 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292572 WP_002988079.1 NZ_LS483442:1563599-1563886 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J7M9F1

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References