Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 704890..705527 | Replicon | chromosome |
Accession | NZ_LS483438 | ||
Organism | Haemophilus influenzae strain NCTC12975 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | E4QWH2 |
Locus tag | DQN45_RS03565 | Protein ID | WP_005649049.1 |
Coordinates | 704890..705294 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | E4QWH3 |
Locus tag | DQN45_RS03570 | Protein ID | WP_005649046.1 |
Coordinates | 705291..705527 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN45_RS03535 | 700448..701014 | + | 567 | WP_005662944.1 | elongation factor P | - |
DQN45_RS03545 | 701366..701953 | - | 588 | WP_005654063.1 | primosomal replication protein | - |
DQN45_RS03550 | 701986..703338 | - | 1353 | WP_005688977.1 | Na+/H+ antiporter family protein | - |
DQN45_RS03555 | 703653..704342 | - | 690 | WP_005688979.1 | ribonuclease T | - |
DQN45_RS03560 | 704416..704823 | - | 408 | WP_005688980.1 | lactoylglutathione lyase | - |
DQN45_RS03565 | 704890..705294 | - | 405 | WP_005649049.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DQN45_RS03570 | 705291..705527 | - | 237 | WP_005649046.1 | antitoxin | Antitoxin |
DQN45_RS03575 | 705620..706345 | - | 726 | WP_005688983.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
DQN45_RS03580 | 706398..706916 | - | 519 | WP_005688985.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
DQN45_RS03585 | 707136..708902 | + | 1767 | WP_005688987.1 | aspartate--tRNA ligase | - |
DQN45_RS03590 | 708964..709836 | + | 873 | WP_005688989.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15692.29 Da Isoelectric Point: 8.9777
>T292569 WP_005649049.1 NZ_LS483438:c705294-704890 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|