Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1654440..1655052 Replicon chromosome
Accession NZ_LS483437
Organism Streptococcus pyogenes strain NCTC13751

Toxin (Protein)


Gene name parE Uniprot ID Q1JEY4
Locus tag DQN29_RS08695 Protein ID WP_020905490.1
Coordinates 1654717..1655052 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQN29_RS08690 Protein ID WP_002988079.1
Coordinates 1654440..1654727 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN29_RS08665 1649621..1650604 - 984 WP_020905487.1 tagatose-bisphosphate aldolase -
DQN29_RS08670 1650608..1651537 - 930 WP_076639463.1 tagatose-6-phosphate kinase -
DQN29_RS08675 1651583..1652098 - 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
DQN29_RS08680 1652133..1652561 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
DQN29_RS08685 1653006..1653779 + 774 WP_011285171.1 DeoR/GlpR family DNA-binding transcription regulator -
DQN29_RS08690 1654440..1654727 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQN29_RS08695 1654717..1655052 + 336 WP_020905490.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQN29_RS09980 1655204..1655674 + 471 Protein_1616 tyrosine-type recombinase/integrase family protein -
DQN29_RS09985 1656036..1656137 + 102 WP_180372495.1 hypothetical protein -
DQN29_RS08715 1656305..1656697 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQN29_RS08720 1656718..1657164 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQN29_RS08725 1657382..1657588 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
DQN29_RS08730 1657585..1658283 - 699 WP_161237464.1 hypothetical protein -
DQN29_RS08735 1658419..1659279 - 861 WP_002982687.1 DegV family protein -
DQN29_RS08740 1659376..1659894 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13147.98 Da        Isoelectric Point: 4.9405

>T292565 WP_020905490.1 NZ_LS483437:1654717-1655052 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIILYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292565 WP_002988079.1 NZ_LS483437:1654440-1654727 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q1JEY4

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References