Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1508078..1508690 Replicon chromosome
Accession NZ_LS483430
Organism Streptococcus pyogenes strain NCTC12044

Toxin (Protein)


Gene name parE Uniprot ID A0A4Z2JY48
Locus tag DQN28_RS07650 Protein ID WP_002982731.1
Coordinates 1508355..1508690 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQN28_RS07645 Protein ID WP_002988079.1
Coordinates 1508078..1508365 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN28_RS07620 1503270..1504253 - 984 WP_002988088.1 tagatose-bisphosphate aldolase -
DQN28_RS07625 1504257..1505186 - 930 WP_002988085.1 tagatose-6-phosphate kinase -
DQN28_RS07630 1505232..1505747 - 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
DQN28_RS07635 1505782..1506210 - 429 WP_014635709.1 galactose-6-phosphate isomerase subunit LacA -
DQN28_RS07640 1506655..1507428 + 774 WP_011285171.1 DeoR/GlpR family DNA-binding transcription regulator -
DQN28_RS07645 1508078..1508365 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQN28_RS07650 1508355..1508690 + 336 WP_002982731.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQN28_RS09020 1508842..1509312 + 471 Protein_1401 integrase -
DQN28_RS07665 1509426..1509776 + 351 WP_111679863.1 tyrosine-type recombinase/integrase -
DQN28_RS07670 1509944..1510336 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQN28_RS07675 1510357..1510803 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQN28_RS07680 1511021..1511227 - 207 WP_111686379.1 helix-turn-helix transcriptional regulator -
DQN28_RS07685 1511224..1511922 - 699 WP_023080151.1 hypothetical protein -
DQN28_RS07690 1512058..1512918 - 861 WP_002982687.1 DegV family protein -
DQN28_RS07695 1513015..1513533 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13145.88 Da        Isoelectric Point: 5.2144

>T292562 WP_002982731.1 NZ_LS483430:1508355-1508690 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292562 WP_002988079.1 NZ_LS483430:1508078-1508365 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Z2JY48

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References