Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 1458432..1459085 | Replicon | chromosome |
Accession | NZ_LS483429 | ||
Organism | Haemophilus aegyptius strain NCTC8502 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DQN49_RS07710 | Protein ID | WP_006996056.1 |
Coordinates | 1458693..1459085 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A5C2R5S0 |
Locus tag | DQN49_RS07705 | Protein ID | WP_006996057.1 |
Coordinates | 1458432..1458692 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN49_RS07690 | 1454283..1455248 | - | 966 | WP_006996060.1 | tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB | - |
DQN49_RS07695 | 1455245..1456759 | - | 1515 | WP_006996059.1 | sodium/proline symporter PutP | - |
DQN49_RS07700 | 1456874..1458349 | + | 1476 | WP_006996058.1 | ribonuclease G | - |
DQN49_RS07705 | 1458432..1458692 | + | 261 | WP_006996057.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DQN49_RS07710 | 1458693..1459085 | + | 393 | WP_006996056.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DQN49_RS07715 | 1459437..1460959 | + | 1523 | Protein_1469 | YadA-like family protein | - |
DQN49_RS07720 | 1461125..1462792 | + | 1668 | WP_006996054.1 | glutamine--tRNA ligase | - |
DQN49_RS07725 | 1462871..1463302 | + | 432 | WP_167395599.1 | YcgN family cysteine cluster protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14758.20 Da Isoelectric Point: 4.6908
>T292559 WP_006996056.1 NZ_LS483429:1458693-1459085 [Haemophilus aegyptius]
MYMLDTNTVSYFFRKVPSVVERLRLLNPEILCISSVTAAELFYGVAKRNNLQLSQFLDIFLSAISILEWDTKTAEIYGKL
RAEMEKEGKVMGVQDQMIAAHALANECVLVTSDKAFEFVPNLILENWCSV
MYMLDTNTVSYFFRKVPSVVERLRLLNPEILCISSVTAAELFYGVAKRNNLQLSQFLDIFLSAISILEWDTKTAEIYGKL
RAEMEKEGKVMGVQDQMIAAHALANECVLVTSDKAFEFVPNLILENWCSV
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|