Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 47497..48128 | Replicon | chromosome |
Accession | NZ_LS483429 | ||
Organism | Haemophilus aegyptius strain NCTC8502 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q4QLW0 |
Locus tag | DQN49_RS00235 | Protein ID | WP_005651560.1 |
Coordinates | 47730..48128 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q4QLV9 |
Locus tag | DQN49_RS00230 | Protein ID | WP_005648011.1 |
Coordinates | 47497..47730 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN49_RS00205 | 42976..44178 | - | 1203 | WP_006995609.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
DQN49_RS00210 | 44342..45007 | + | 666 | WP_013527272.1 | DNA repair protein RadC | - |
DQN49_RS00215 | 45221..45457 | + | 237 | WP_006995608.1 | 50S ribosomal protein L28 | - |
DQN49_RS00220 | 45469..45639 | + | 171 | WP_005613503.1 | 50S ribosomal protein L33 | - |
DQN49_RS00225 | 45986..47350 | + | 1365 | WP_006995606.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
DQN49_RS00230 | 47497..47730 | + | 234 | WP_005648011.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
DQN49_RS00235 | 47730..48128 | + | 399 | WP_005651560.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
DQN49_RS00240 | 48148..49683 | + | 1536 | WP_006995605.1 | L-2,4-diaminobutyrate decarboxylase | - |
DQN49_RS00245 | 49926..50741 | + | 816 | WP_005648023.1 | DNA-formamidopyrimidine glycosylase | - |
DQN49_RS00250 | 50815..51837 | - | 1023 | WP_065246977.1 | outer membrane-stress sensor serine endopeptidase DegS | - |
DQN49_RS00255 | 51838..52956 | - | 1119 | WP_006995603.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15115.46 Da Isoelectric Point: 8.0514
>T292556 WP_005651560.1 NZ_LS483429:47730-48128 [Haemophilus aegyptius]
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4QLW0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806DGS0 |