292555

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 979088..979638 Replicon chromosome
Accession NZ_LS483426
Organism Kingella kingae strain NCTC10529

Toxin (Protein)


Gene name relE Uniprot ID F5S5C3
Locus tag DQN52_RS05300 Protein ID WP_003785639.1
Coordinates 979369..979638 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID F5S5C2
Locus tag DQN52_RS05295 Protein ID WP_003785638.1
Coordinates 979088..979372 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN52_RS05260 975218..976075 - 858 WP_003785631.1 tyrosine-type recombinase/integrase -
DQN52_RS05265 976139..976492 + 354 WP_003785632.1 phage holin family protein -
DQN52_RS05270 976473..977003 + 531 WP_003785633.1 glycoside hydrolase family 108 protein -
DQN52_RS05275 977000..977317 + 318 WP_003785634.1 hypothetical protein -
DQN52_RS05280 977523..977741 + 219 WP_003785635.1 TraR/DksA C4-type zinc finger protein -
DQN52_RS05285 977728..978159 + 432 WP_003785636.1 phage tail protein -
DQN52_RS05290 978163..978897 + 735 WP_003785637.1 phage virion morphogenesis protein -
DQN52_RS05295 979088..979372 + 285 WP_003785638.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
DQN52_RS05300 979369..979638 + 270 WP_003785639.1 type II toxin-antitoxin system YafQ family toxin Toxin
DQN52_RS05305 979797..980405 + 609 WP_003785640.1 phage baseplate assembly protein V -
DQN52_RS05310 980402..980737 + 336 WP_003785641.1 GPW/gp25 family protein -
DQN52_RS05315 980734..981630 + 897 WP_003785643.1 baseplate J/gp47 family protein -
DQN52_RS05320 981627..982208 + 582 WP_003785645.1 phage tail protein I -
DQN52_RS11165 982226..983626 + 1401 WP_111694425.1 phage tail protein -
DQN52_RS05330 983639..983848 + 210 WP_032133698.1 hypothetical protein -
DQN52_RS05335 983835..984149 + 315 Protein_1002 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 951675..999204 47529


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-77)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10329.98 Da        Isoelectric Point: 7.2429

>T292555 WP_003785639.1 NZ_LS483426:979369-979638 [Kingella kingae]
MSREIIFQGQFKRDVKKQFLELATVEWAEVLTCLVNDLPLAEKYRDHALVNDKNGYRDCHIKPDLVLIYGRKENALILVR
LGSHSEIFG

Download         Length: 270 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10648.21 Da        Isoelectric Point: 7.0134

>AT292555 WP_003785638.1 NZ_LS483426:979088-979372 [Kingella kingae]
MSAINFNIRMDKSLKERAFPVIESYGLTPAQAVKLFFNQIATTQTIPISFEHNVNRIPNAITRKAIEDAESEFETAKRYK
TVEEAIAAMQELAK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB F5S5C3

Antitoxin

Source ID Structure
AlphaFold DB F5S5C2

References