Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 711839..712485 | Replicon | chromosome |
| Accession | NZ_LS483426 | ||
| Organism | Kingella kingae strain NCTC10529 | ||
Toxin (Protein)
| Gene name | VapC1 | Uniprot ID | F5S4I4 |
| Locus tag | DQN52_RS03890 | Protein ID | WP_003785163.1 |
| Coordinates | 712078..712485 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | VapB1 | Uniprot ID | F5S4I3 |
| Locus tag | DQN52_RS03885 | Protein ID | WP_003785161.1 |
| Coordinates | 711839..712081 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN52_RS03860 | 707236..707979 | + | 744 | WP_003785156.1 | IS110 family transposase | - |
| DQN52_RS03865 | 708244..708327 | + | 84 | Protein_717 | IS5/IS1182 family transposase | - |
| DQN52_RS03875 | 708763..709572 | - | 810 | WP_003785159.1 | hypothetical protein | - |
| DQN52_RS03880 | 709659..711698 | - | 2040 | WP_003785160.1 | excinuclease ABC subunit B | - |
| DQN52_RS03885 | 711839..712081 | + | 243 | WP_003785161.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| DQN52_RS03890 | 712078..712485 | + | 408 | WP_003785163.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DQN52_RS03895 | 712545..713042 | - | 498 | WP_003785166.1 | thiol peroxidase | - |
| DQN52_RS03900 | 713136..713636 | - | 501 | WP_003785168.1 | hypothetical protein | - |
| DQN52_RS03905 | 713727..714905 | - | 1179 | WP_003785170.1 | phosphoglycerate kinase | - |
| DQN52_RS03910 | 714985..715617 | - | 633 | WP_003791386.1 | pyridoxamine 5'-phosphate oxidase | - |
| DQN52_RS03915 | 715837..717087 | + | 1251 | WP_003785176.1 | glutamyl-tRNA reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15241.45 Da Isoelectric Point: 6.8791
>T292554 WP_003785163.1 NZ_LS483426:712078-712485 [Kingella kingae]
MMYLLDTNILIYIQKNNPPTVREKINNLPNSAQLVMSFVTYAELLKGTYGSQNLEKAQANLNALTRIISVLPSHEAMPEH
YANWANQLKKQGKPIGNNDLWIAAHALAVGAVLVTHNTKEFSRINNLQLEDWVEE
MMYLLDTNILIYIQKNNPPTVREKINNLPNSAQLVMSFVTYAELLKGTYGSQNLEKAQANLNALTRIISVLPSHEAMPEH
YANWANQLKKQGKPIGNNDLWIAAHALAVGAVLVTHNTKEFSRINNLQLEDWVEE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|