Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 3240671..3241332 | Replicon | chromosome |
Accession | NZ_LS483424 | ||
Organism | Bordetella parapertussis strain NCTC10520 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q7WAH5 |
Locus tag | DQO06_RS15245 | Protein ID | WP_003812073.1 |
Coordinates | 3240907..3241332 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DQO06_RS15240 | Protein ID | WP_003812071.1 |
Coordinates | 3240671..3240910 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQO06_RS15205 | 3235706..3236509 | - | 804 | WP_003812055.1 | bacteriocin family protein | - |
DQO06_RS15210 | 3236506..3237552 | - | 1047 | WP_010928022.1 | Dyp-type peroxidase | - |
DQO06_RS15215 | 3237630..3238190 | - | 561 | WP_010928021.1 | DUF488 domain-containing protein | - |
DQO06_RS15220 | 3238187..3238420 | - | 234 | WP_033447224.1 | DUF2945 domain-containing protein | - |
DQO06_RS15225 | 3238501..3239013 | - | 513 | WP_003812062.1 | redoxin domain-containing protein | - |
DQO06_RS15230 | 3239072..3239617 | - | 546 | WP_010928020.1 | peroxidase-related enzyme | - |
DQO06_RS15235 | 3239755..3240597 | + | 843 | WP_010928019.1 | AraC family transcriptional regulator | - |
DQO06_RS15240 | 3240671..3240910 | + | 240 | WP_003812071.1 | Arc family DNA-binding protein | Antitoxin |
DQO06_RS15245 | 3240907..3241332 | + | 426 | WP_003812073.1 | PIN domain-containing protein | Toxin |
DQO06_RS15250 | 3241442..3241906 | + | 465 | WP_003812075.1 | MarR family transcriptional regulator | - |
DQO06_RS15255 | 3242004..3243509 | - | 1506 | WP_010928018.1 | tripartite tricarboxylate transporter permease | - |
DQO06_RS15260 | 3244008..3244520 | + | 513 | WP_010928017.1 | hypothetical protein | - |
DQO06_RS15265 | 3244541..3245518 | - | 978 | WP_003812083.1 | tripartite tricarboxylate transporter substrate binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14811.22 Da Isoelectric Point: 6.3704
>T292553 WP_003812073.1 NZ_LS483424:3240907-3241332 [Bordetella parapertussis]
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|