Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2519995..2520589 Replicon chromosome
Accession NZ_LS483424
Organism Bordetella parapertussis strain NCTC10520

Toxin (Protein)


Gene name hicA Uniprot ID K0M8J0
Locus tag DQO06_RS11775 Protein ID WP_010928352.1
Coordinates 2519995..2520177 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID K0MFV7
Locus tag DQO06_RS11780 Protein ID WP_010928351.1
Coordinates 2520200..2520589 (+) Length 130 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQO06_RS11755 2514998..2515738 + 741 WP_003809659.1 carbonic anhydrase -
DQO06_RS11760 2515750..2517105 - 1356 WP_003809657.1 cytochrome c -
DQO06_RS11765 2517116..2518885 - 1770 WP_010928353.1 GMC family oxidoreductase -
DQO06_RS11770 2518889..2519587 - 699 WP_003809653.1 gluconate 2-dehydrogenase subunit 3 family protein -
DQO06_RS11775 2519995..2520177 + 183 WP_010928352.1 type II toxin-antitoxin system HicA family toxin Toxin
DQO06_RS11780 2520200..2520589 + 390 WP_010928351.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
DQO06_RS11790 2520855..2521631 - 777 WP_033448479.1 phosphate ABC transporter ATP-binding protein PstB -
DQO06_RS11795 2521676..2522533 - 858 WP_003809638.1 phosphate ABC transporter permease PstA -
DQO06_RS11800 2522555..2523571 - 1017 WP_010928350.1 phosphate ABC transporter permease subunit PstC -
DQO06_RS11805 2523706..2524746 - 1041 WP_003809635.1 phosphate ABC transporter substrate-binding protein PstS -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-122)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6750.76 Da        Isoelectric Point: 11.4018

>T292551 WP_010928352.1 NZ_LS483424:2519995-2520177 [Bordetella parapertussis]
MNSTDLIQQPKADGWYRVHTVGSHHQYKHPTKPGKVTVPHPRKGLPTATQRSILKQAGLR

Download         Length: 183 bp

Antitoxin


Download         Length: 130 a.a.        Molecular weight: 14270.92 Da        Isoelectric Point: 4.3014

>AT292551 WP_010928351.1 NZ_LS483424:2520200-2520589 [Bordetella parapertussis]
MLYPIHVSKDEGSAYGAAFPDFPGCFAAADELQDLPRAAQEAVEAHFYGETERIPAPSAPEAWANDEDYQGGYWMMVDID
LSKVNTKAVRLNISLPENLVHRIDEEAKARRLSRSAFLAMAAEHEMADA

Download         Length: 390 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB K0M8J0

Antitoxin

Source ID Structure
AlphaFold DB K0MFV7

References