Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1363905..1364541 | Replicon | chromosome |
| Accession | NZ_LS483424 | ||
| Organism | Bordetella parapertussis strain NCTC10520 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q7W5Z1 |
| Locus tag | DQO06_RS06400 | Protein ID | WP_010928914.1 |
| Coordinates | 1364359..1364541 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q7W5Z0 |
| Locus tag | DQO06_RS06395 | Protein ID | WP_010928915.1 |
| Coordinates | 1363905..1364297 (-) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQO06_RS06370 | 1359561..1359987 | - | 427 | Protein_1251 | OB-fold domain-containing protein | - |
| DQO06_RS06375 | 1359991..1361163 | - | 1173 | WP_010928918.1 | thiolase domain-containing protein | - |
| DQO06_RS06380 | 1361230..1361589 | - | 360 | WP_010928917.1 | hypothetical protein | - |
| DQO06_RS06385 | 1361624..1362598 | - | 975 | WP_010928916.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| DQO06_RS06390 | 1362723..1363632 | + | 910 | Protein_1255 | LysR family transcriptional regulator | - |
| DQO06_RS06395 | 1363905..1364297 | - | 393 | WP_010928915.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DQO06_RS06400 | 1364359..1364541 | - | 183 | WP_010928914.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DQO06_RS06410 | 1365090..1366310 | - | 1221 | WP_010928912.1 | ISL3-like element IS1001 family transposase | - |
| DQO06_RS06420 | 1366886..1368073 | - | 1188 | WP_010928911.1 | MFS transporter | - |
| DQO06_RS06425 | 1368291..1368968 | - | 678 | WP_010928910.1 | HAD-IA family hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1365090..1366310 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6572.69 Da Isoelectric Point: 10.9062
>T292549 WP_010928914.1 NZ_LS483424:c1364541-1364359 [Bordetella parapertussis]
MDGKELIKQLERSGWTLRSVKGSHHVFAHPDRPGHISVPHPKKDLGIGLLNSILKAAGLK
MDGKELIKQLERSGWTLRSVKGSHHVFAHPDRPGHISVPHPKKDLGIGLLNSILKAAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14058.82 Da Isoelectric Point: 4.2876
>AT292549 WP_010928915.1 NZ_LS483424:c1364297-1363905 [Bordetella parapertussis]
VKYPIAIEPGSDTRAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIPAATNIANHQANPEFANWIWA
IADVDPAVLDETVERVNITIPRRILKRLDDRARAAGESRSSYIAHLAMTA
VKYPIAIEPGSDTRAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIPAATNIANHQANPEFANWIWA
IADVDPAVLDETVERVNITIPRRILKRLDDRARAAGESRSSYIAHLAMTA
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|