Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4002947..4003484 | Replicon | chromosome |
| Accession | NZ_LS483422 | ||
| Organism | Providencia heimbachae strain NCTC12003 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1B7JVG2 |
| Locus tag | DQN80_RS18265 | Protein ID | WP_068908568.1 |
| Coordinates | 4002947..4003240 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1B7JVD7 |
| Locus tag | DQN80_RS18270 | Protein ID | WP_068908569.1 |
| Coordinates | 4003230..4003484 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN80_RS18235 | 3998441..3999721 | - | 1281 | WP_068908562.1 | N-acetylmuramoyl-L-alanine amidase AmiB | - |
| DQN80_RS18240 | 3999736..4000200 | - | 465 | WP_068439823.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| DQN80_RS18245 | 4000551..4001708 | + | 1158 | WP_068908566.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| DQN80_RS18265 | 4002947..4003240 | - | 294 | WP_068908568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQN80_RS18270 | 4003230..4003484 | - | 255 | WP_068908569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| DQN80_RS18275 | 4003606..4004148 | - | 543 | WP_068908571.1 | oligoribonuclease | - |
| DQN80_RS18280 | 4004273..4005325 | + | 1053 | WP_068908573.1 | small ribosomal subunit biogenesis GTPase RsgA | - |
| DQN80_RS18285 | 4005521..4006420 | + | 900 | WP_197713312.1 | phosphatidylserine decarboxylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11444.36 Da Isoelectric Point: 10.3916
>T292544 WP_068908568.1 NZ_LS483422:c4003240-4002947 [Providencia heimbachae]
MIFNIEFDERALKEWNKLDSSVREQFKKKLKKLQTNPYIESARLNGEQSNCYKIKLRSSGYRLVYQIIDSEIVIFVIAIG
KRDAQKAYKVANIRLTK
MIFNIEFDERALKEWNKLDSSVREQFKKKLKKLQTNPYIESARLNGEQSNCYKIKLRSSGYRLVYQIIDSEIVIFVIAIG
KRDAQKAYKVANIRLTK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JVG2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JVD7 |