Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2834634..2835181 Replicon chromosome
Accession NZ_LS483422
Organism Providencia heimbachae strain NCTC12003

Toxin (Protein)


Gene name ccdB Uniprot ID A0A1B7K060
Locus tag DQN80_RS12780 Protein ID WP_068907667.1
Coordinates 2834873..2835181 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1B7K057
Locus tag DQN80_RS12775 Protein ID WP_068442587.1
Coordinates 2834634..2834873 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN80_RS12755 2830107..2830409 + 303 WP_068907666.1 flagellar biosynthesis anti-sigma factor FlgM -
DQN80_RS12760 2830417..2830857 + 441 WP_068442595.1 flagellar export chaperone FlgN -
DQN80_RS12765 2831130..2833226 - 2097 WP_068442592.1 flagellar biosynthesis protein FlhA -
DQN80_RS12770 2833219..2834370 - 1152 WP_068442590.1 flagellar type III secretion system protein FlhB -
DQN80_RS12775 2834634..2834873 + 240 WP_068442587.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
DQN80_RS12780 2834873..2835181 + 309 WP_068907667.1 CcdB family protein Toxin
DQN80_RS12785 2835222..2835779 + 558 WP_068907669.1 hypothetical protein -
DQN80_RS12790 2835834..2836133 - 300 WP_068442579.1 helix-turn-helix domain-containing protein -
DQN80_RS12795 2836123..2836460 - 338 Protein_2492 type II toxin-antitoxin system RelE/ParE family toxin -
DQN80_RS12800 2836737..2837375 - 639 WP_068442576.1 protein phosphatase CheZ -
DQN80_RS12805 2837400..2837792 - 393 WP_068442573.1 chemotaxis response regulator CheY -
DQN80_RS12810 2837833..2838900 - 1068 WP_068442570.1 chemotaxis response regulator protein-glutamate methylesterase -
DQN80_RS12815 2838900..2839736 - 837 WP_068446439.1 chemotaxis protein CheR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 12000.23 Da        Isoelectric Point: 9.2919

>T292543 WP_068907667.1 NZ_LS483422:2834873-2835181 [Providencia heimbachae]
MQYHLYLNRGDRIRYPYLLDIQSDIIDMLNTRLVIPLYDSKLVQKPLPERLNPIIYIDTHAFILMTHQMASVPLSVLGKK
VIHIKNEREKIKQAIDLLIDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9130.45 Da        Isoelectric Point: 9.9636

>AT292543 WP_068442587.1 NZ_LS483422:2834634-2834873 [Providencia heimbachae]
MSSTAHRMKKTVSVTVTPELYEQARRAKLNFSAILSNALIIELKKAEALKWKEQNREGFNELNRISDENGLLSDKYKEF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1B7K060

Antitoxin

Source ID Structure
AlphaFold DB A0A1B7K057

References