Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 2332908..2333827 | Replicon | chromosome |
| Accession | NZ_LS483422 | ||
| Organism | Providencia heimbachae strain NCTC12003 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A1B7K391 |
| Locus tag | DQN80_RS10345 | Protein ID | WP_068907218.1 |
| Coordinates | 2333369..2333827 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A1B7K397 |
| Locus tag | DQN80_RS10340 | Protein ID | WP_068907217.1 |
| Coordinates | 2332908..2333372 (+) | Length | 155 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN80_RS10305 | 2328483..2329097 | + | 615 | WP_068443763.1 | LysE family translocator | - |
| DQN80_RS10310 | 2329108..2329572 | - | 465 | WP_068907214.1 | NUDIX domain-containing protein | - |
| DQN80_RS10320 | 2329975..2330616 | - | 642 | WP_068443749.1 | leucine efflux protein LeuE | - |
| DQN80_RS10325 | 2331114..2331815 | + | 702 | WP_068907215.1 | AzlC family ABC transporter permease | - |
| DQN80_RS10330 | 2331812..2332126 | + | 315 | WP_068907216.1 | AzlD domain-containing protein | - |
| DQN80_RS10335 | 2332347..2332826 | + | 480 | WP_068443741.1 | DUF1456 family protein | - |
| DQN80_RS10340 | 2332908..2333372 | + | 465 | WP_068907217.1 | DUF2384 domain-containing protein | Antitoxin |
| DQN80_RS10345 | 2333369..2333827 | + | 459 | WP_068907218.1 | RES domain-containing protein | Toxin |
| DQN80_RS10350 | 2333828..2334718 | - | 891 | WP_068907219.1 | LysR family transcriptional regulator | - |
| DQN80_RS10355 | 2334765..2335724 | - | 960 | WP_068443729.1 | acetyl-CoA carboxylase carboxyl transferase subunit alpha | - |
| DQN80_RS10360 | 2335845..2336261 | - | 417 | WP_068443727.1 | helix-turn-helix domain-containing protein | - |
| DQN80_RS10365 | 2336298..2336861 | - | 564 | WP_068443724.1 | GNAT family N-acetyltransferase | - |
| DQN80_RS10370 | 2336842..2338308 | - | 1467 | WP_197713306.1 | AMP nucleosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | galU / vipA/tssB / vipB/tssC / hcp/tssD / clpV/tssH | 2119492..2382512 | 263020 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17236.68 Da Isoelectric Point: 6.4850
>T292542 WP_068907218.1 NZ_LS483422:2333369-2333827 [Providencia heimbachae]
MILYRLIKSDFVHDAWSGQGARLYGGRWNHKGTSAVYVSTQISLATLEILVHLNQERLLNHYNLFSIEISDKQVMRLPLE
HLPDDWQSDPAPTSTMDIGTAWLTDNASVALLIPSCVIPYEYNAIINPNHPQFTKAINSIKPLDFSFDARLK
MILYRLIKSDFVHDAWSGQGARLYGGRWNHKGTSAVYVSTQISLATLEILVHLNQERLLNHYNLFSIEISDKQVMRLPLE
HLPDDWQSDPAPTSTMDIGTAWLTDNASVALLIPSCVIPYEYNAIINPNHPQFTKAINSIKPLDFSFDARLK
Download Length: 459 bp
Antitoxin
Download Length: 155 a.a. Molecular weight: 17226.76 Da Isoelectric Point: 9.9134
>AT292542 WP_068907217.1 NZ_LS483422:2332908-2333372 [Providencia heimbachae]
MRNYIPTLPTSNIVSPTFKPLWRFAGLPAERGVELTHFLRQGLSVNVLDNIQEWSGMSKAELLRISGINERNFARRKNAG
QPLNTDESERIARLVRVFDAAVRLFNGDKVAANDWLNHPVKGLGHLRPIELIATESGALEVIDLIGRIEQGVFS
MRNYIPTLPTSNIVSPTFKPLWRFAGLPAERGVELTHFLRQGLSVNVLDNIQEWSGMSKAELLRISGINERNFARRKNAG
QPLNTDESERIARLVRVFDAAVRLFNGDKVAANDWLNHPVKGLGHLRPIELIATESGALEVIDLIGRIEQGVFS
Download Length: 465 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7K391 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7K397 |