Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1477187..1477844 | Replicon | chromosome |
Accession | NZ_LS483422 | ||
Organism | Providencia heimbachae strain NCTC12003 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1B7JKI9 |
Locus tag | DQN80_RS06435 | Protein ID | WP_068445594.1 |
Coordinates | 1477434..1477844 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A1B7JKJ9 |
Locus tag | DQN80_RS06430 | Protein ID | WP_068445596.1 |
Coordinates | 1477187..1477453 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN80_RS06415 | 1472374..1475250 | + | 2877 | WP_068909905.1 | aminomethyl-transferring glycine dehydrogenase | - |
DQN80_RS06420 | 1475317..1475937 | - | 621 | WP_068445600.1 | HD domain-containing protein | - |
DQN80_RS06425 | 1475949..1476935 | - | 987 | WP_068909907.1 | tRNA-modifying protein YgfZ | - |
DQN80_RS06430 | 1477187..1477453 | + | 267 | WP_068445596.1 | FAD assembly factor SdhE | Antitoxin |
DQN80_RS06435 | 1477434..1477844 | + | 411 | WP_068445594.1 | hypothetical protein | Toxin |
DQN80_RS06440 | 1477902..1478420 | - | 519 | WP_068909908.1 | flavodoxin FldB | - |
DQN80_RS06445 | 1478560..1479462 | + | 903 | WP_068445591.1 | site-specific tyrosine recombinase XerD | - |
DQN80_RS06450 | 1479482..1480183 | + | 702 | WP_068909910.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
DQN80_RS06455 | 1480192..1481925 | + | 1734 | WP_068909912.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15619.56 Da Isoelectric Point: 10.7186
>T292540 WP_068445594.1 NZ_LS483422:1477434-1477844 [Providencia heimbachae]
VVLWKSNLAISWKTQLFSTCIHGVIGAFVLIAPWVSETSMIWLPLLVVIVASWAKSQKNISKIKGIVVLVNGNKVQWKKN
EWYIDKAPWRSRFGILLTLSALQGKPKKIHLWIAKDTVSEENWRNLNQLLLQYPDI
VVLWKSNLAISWKTQLFSTCIHGVIGAFVLIAPWVSETSMIWLPLLVVIVASWAKSQKNISKIKGIVVLVNGNKVQWKKN
EWYIDKAPWRSRFGILLTLSALQGKPKKIHLWIAKDTVSEENWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JKI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JKJ9 |