Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 890249..890891 | Replicon | chromosome |
Accession | NZ_LS483422 | ||
Organism | Providencia heimbachae strain NCTC12003 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1B7JP77 |
Locus tag | DQN80_RS03845 | Protein ID | WP_068439370.1 |
Coordinates | 890249..890452 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A1B7JPC0 |
Locus tag | DQN80_RS03850 | Protein ID | WP_068439372.1 |
Coordinates | 890523..890891 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN80_RS03820 | 886214..886552 | + | 339 | WP_068909458.1 | P-II family nitrogen regulator | - |
DQN80_RS03825 | 886563..887846 | + | 1284 | WP_068439364.1 | ammonium transporter AmtB | - |
DQN80_RS03830 | 887961..888827 | - | 867 | WP_068909460.1 | acyl-CoA thioesterase II | - |
DQN80_RS03835 | 889148..889606 | + | 459 | WP_068439368.1 | YbaY family lipoprotein | - |
DQN80_RS03845 | 890249..890452 | - | 204 | WP_068439370.1 | hemolysin expression modulator Hha | Toxin |
DQN80_RS03850 | 890523..890891 | - | 369 | WP_068439372.1 | Hha toxicity modulator TomB | Antitoxin |
DQN80_RS03855 | 891537..892907 | - | 1371 | WP_068909462.1 | murein transglycosylase D | - |
DQN80_RS03860 | 892989..893744 | - | 756 | WP_068439376.1 | hydroxyacylglutathione hydrolase | - |
DQN80_RS03865 | 893778..894506 | + | 729 | WP_068439378.1 | methyltransferase domain-containing protein | - |
DQN80_RS03870 | 894517..894987 | - | 471 | WP_068439381.1 | ribonuclease HI | - |
DQN80_RS03875 | 895047..895808 | + | 762 | WP_068439382.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8161.50 Da Isoelectric Point: 6.9775
>T292539 WP_068439370.1 NZ_LS483422:c890452-890249 [Providencia heimbachae]
MTKFDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MTKFDYLMRLRKCTTIETLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14181.08 Da Isoelectric Point: 4.3945
>AT292539 WP_068439372.1 NZ_LS483422:c890891-890523 [Providencia heimbachae]
MDEYSPKKHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSQQSANLNELIEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYDLFGSPVITLSEIIDWESMNQNLVSVLEDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSQQSANLNELIEHIAAFVWRFKIKYPKENLVISLVEEYL
DETYDLFGSPVITLSEIIDWESMNQNLVSVLEDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JP77 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JPC0 |