Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1538382..1538994 | Replicon | chromosome |
| Accession | NZ_LS483421 | ||
| Organism | Streptococcus pyogenes strain NCTC10877 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0H3C0F8 |
| Locus tag | DQN31_RS07800 | Protein ID | WP_009880846.1 |
| Coordinates | 1538659..1538994 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQN31_RS07795 | Protein ID | WP_002988079.1 |
| Coordinates | 1538382..1538669 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN31_RS07770 | 1533561..1534544 | - | 984 | WP_014407847.1 | tagatose-bisphosphate aldolase | - |
| DQN31_RS07775 | 1534548..1535477 | - | 930 | WP_111697165.1 | tagatose-6-phosphate kinase | - |
| DQN31_RS07780 | 1535523..1536038 | - | 516 | WP_014407849.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQN31_RS07785 | 1536073..1536501 | - | 429 | WP_014407850.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQN31_RS07790 | 1536948..1537721 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQN31_RS07795 | 1538382..1538669 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQN31_RS07800 | 1538659..1538994 | + | 336 | WP_009880846.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQN31_RS09100 | 1539146..1539616 | + | 471 | Protein_1420 | integrase | - |
| DQN31_RS09105 | 1539978..1540127 | + | 150 | WP_011285175.1 | integrase | - |
| DQN31_RS07825 | 1540259..1540651 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQN31_RS07830 | 1540672..1541118 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQN31_RS07835 | 1541336..1541542 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQN31_RS07840 | 1541539..1542237 | - | 699 | WP_014407851.1 | hypothetical protein | - |
| DQN31_RS07845 | 1542373..1543233 | - | 861 | WP_011529009.1 | DegV family protein | - |
| DQN31_RS07850 | 1543330..1543848 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13204.95 Da Isoelectric Point: 5.6809
>T292537 WP_009880846.1 NZ_LS483421:1538659-1538994 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFREVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFREVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3C0F8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |