Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1530713..1531325 | Replicon | chromosome |
| Accession | NZ_LS483420 | ||
| Organism | Streptococcus pyogenes strain NCTC13739 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQN75_RS07780 | Protein ID | WP_111685196.1 |
| Coordinates | 1530990..1531325 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQN75_RS07775 | Protein ID | WP_002988079.1 |
| Coordinates | 1530713..1531000 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN75_RS07750 | 1525904..1526887 | - | 984 | WP_012561005.1 | tagatose-bisphosphate aldolase | - |
| DQN75_RS07755 | 1526891..1527820 | - | 930 | WP_012561006.1 | tagatose-6-phosphate kinase | - |
| DQN75_RS07760 | 1527866..1528381 | - | 516 | WP_111685194.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQN75_RS07765 | 1528416..1528844 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQN75_RS07770 | 1529290..1530063 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQN75_RS07775 | 1530713..1531000 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQN75_RS07780 | 1530990..1531325 | + | 336 | WP_111685196.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQN75_RS09070 | 1531452..1531946 | + | 495 | WP_187416396.1 | integrase | - |
| DQN75_RS09075 | 1531909..1532442 | + | 534 | WP_136112477.1 | site-specific integrase | - |
| DQN75_RS07795 | 1532574..1532966 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQN75_RS07800 | 1532987..1533433 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQN75_RS07805 | 1533651..1533857 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQN75_RS07810 | 1533854..1534552 | - | 699 | WP_168688170.1 | hypothetical protein | - |
| DQN75_RS07815 | 1534688..1535548 | - | 861 | WP_011529009.1 | DegV family protein | - |
| DQN75_RS07820 | 1535645..1536163 | - | 519 | WP_111685198.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13147.91 Da Isoelectric Point: 6.0913
>T292536 WP_111685196.1 NZ_LS483420:1530990-1531325 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHHHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHHHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|