Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 594230..594716 Replicon chromosome
Accession NZ_LS483418
Organism Streptococcus suis strain NCTC10234

Toxin (Protein)


Gene name relE Uniprot ID D5AGV2
Locus tag DQM62_RS03060 Protein ID WP_011922754.1
Coordinates 594447..594716 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D5AGV1
Locus tag DQM62_RS03055 Protein ID WP_002938604.1
Coordinates 594230..594457 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM62_RS03025 589273..589722 - 450 WP_009909619.1 MarR family transcriptional regulator -
DQM62_RS03030 590016..590863 + 848 WP_087892711.1 IS630 family transposase -
DQM62_RS03035 590922..591419 + 498 WP_011922751.1 DUF5590 domain-containing protein -
DQM62_RS03040 591416..592597 + 1182 WP_014917225.1 pyridoxal phosphate-dependent aminotransferase -
DQM62_RS03045 592612..593958 + 1347 WP_014917226.1 asparagine--tRNA ligase -
DQM62_RS03055 594230..594457 + 228 WP_002938604.1 hypothetical protein Antitoxin
DQM62_RS03060 594447..594716 + 270 WP_011922754.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM62_RS03070 595122..596441 + 1320 WP_014917227.1 MATE family efflux transporter -
DQM62_RS03075 596492..596869 + 378 WP_002937263.1 RidA family protein -
DQM62_RS03080 596891..597778 + 888 WP_011922160.1 RNase adapter RapZ -
DQM62_RS03085 597775..598749 + 975 WP_002937257.1 YvcK family protein -
DQM62_RS03090 598746..599663 + 918 WP_002937252.1 DNA-binding protein WhiA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10437.49 Da        Isoelectric Point: 10.3916

>T292531 WP_011922754.1 NZ_LS483418:594447-594716 [Streptococcus suis]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEI
GHRKEIYKK

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8450.51 Da        Isoelectric Point: 4.1589

>AT292531 WP_002938604.1 NZ_LS483418:594230-594457 [Streptococcus suis]
MGIVSLRLNDAEEEIFRSYAIHTGKSLSELFKTALAEQIEDQLDYEIGIKALKKFQENPVTHSIDDVLAELEDGL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A126UKS2

Antitoxin

Source ID Structure
AlphaFold DB A0A140EXF0

References