Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1632894..1633562 | Replicon | chromosome |
Accession | NZ_LS483417 | ||
Organism | Streptococcus pneumoniae strain NCTC11902 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | G0ICE6 |
Locus tag | DQN54_RS08645 | Protein ID | WP_001132281.1 |
Coordinates | 1633383..1633562 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | DQN54_RS08640 | Protein ID | WP_000961810.1 |
Coordinates | 1632894..1633346 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN54_RS08615 | 1628784..1629527 | - | 744 | WP_001188200.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
DQN54_RS08620 | 1629529..1630479 | - | 951 | WP_000451127.1 | 50S ribosomal protein L11 methyltransferase | - |
DQN54_RS08625 | 1630617..1631045 | - | 429 | WP_000418166.1 | NUDIX hydrolase | - |
DQN54_RS08630 | 1631026..1632114 | - | 1089 | WP_000719716.1 | M50 family metallopeptidase | - |
DQN54_RS08635 | 1632133..1632603 | - | 471 | WP_000257097.1 | DUF3013 family protein | - |
DQN54_RS08640 | 1632894..1633346 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DQN54_RS08645 | 1633383..1633562 | - | 180 | WP_001132281.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DQN54_RS08650 | 1633699..1633878 | - | 180 | WP_001809903.1 | hypothetical protein | - |
DQN54_RS08660 | 1634043..1634282 | - | 240 | WP_000818079.1 | hypothetical protein | - |
DQN54_RS08670 | 1634552..1635823 | + | 1272 | WP_001113209.1 | replication-associated recombination protein A | - |
DQN54_RS08680 | 1636370..1637689 | - | 1320 | WP_000502555.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6677.88 Da Isoelectric Point: 11.0174
>T292530 WP_001132281.1 NZ_LS483417:c1633562-1633383 [Streptococcus pneumoniae]
IPMTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIRKQAGL
IPMTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT292530 WP_000961810.1 NZ_LS483417:c1633346-1632894 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|