Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1680733..1681345 | Replicon | chromosome |
Accession | NZ_LS483414 | ||
Organism | Streptococcus pyogenes strain NCTC13736 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q1JJZ2 |
Locus tag | DQN44_RS08735 | Protein ID | WP_002988077.1 |
Coordinates | 1681010..1681345 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQN44_RS08730 | Protein ID | WP_002988079.1 |
Coordinates | 1680733..1681020 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN44_RS08705 | 1675925..1676908 | - | 984 | WP_111706034.1 | tagatose-bisphosphate aldolase | - |
DQN44_RS08710 | 1676912..1677841 | - | 930 | WP_030127320.1 | tagatose-6-phosphate kinase | - |
DQN44_RS08715 | 1677887..1678402 | - | 516 | WP_030127321.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQN44_RS08720 | 1678437..1678865 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQN44_RS08725 | 1679310..1680083 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQN44_RS08730 | 1680733..1681020 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQN44_RS08735 | 1681010..1681345 | + | 336 | WP_002988077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN44_RS09970 | 1681497..1681967 | + | 471 | WP_030127322.1 | site-specific integrase | - |
DQN44_RS09975 | 1681930..1682478 | + | 549 | WP_180372439.1 | site-specific integrase | - |
DQN44_RS08750 | 1682610..1683002 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQN44_RS08755 | 1683023..1683469 | - | 447 | WP_011018228.1 | 50S ribosomal protein L13 | - |
DQN44_RS08760 | 1683687..1683893 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQN44_RS08765 | 1683890..1684588 | - | 699 | WP_030127323.1 | hypothetical protein | - |
DQN44_RS08770 | 1684724..1685584 | - | 861 | WP_030127324.1 | DegV family protein | - |
DQN44_RS08775 | 1685681..1686199 | - | 519 | WP_011889154.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13117.83 Da Isoelectric Point: 5.2144
>T292527 WP_002988077.1 NZ_LS483414:1681010-1681345 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A660A236 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |