Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 672814..673451 | Replicon | chromosome |
| Accession | NZ_LS483411 | ||
| Organism | Haemophilus influenzae strain NCTC11426 | ||
Toxin (Protein)
| Gene name | VapC1 | Uniprot ID | A0A121YHB9 |
| Locus tag | DQN24_RS03405 | Protein ID | WP_021035685.1 |
| Coordinates | 673047..673451 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | VapB1 | Uniprot ID | A0A0H3PN67 |
| Locus tag | DQN24_RS03400 | Protein ID | WP_005656316.1 |
| Coordinates | 672814..673050 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN24_RS03375 | 668041..668781 | - | 741 | WP_005662961.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| DQN24_RS03380 | 668941..669417 | - | 477 | WP_021035689.1 | dihydroneopterin triphosphate diphosphatase | - |
| DQN24_RS03385 | 669439..671205 | - | 1767 | WP_111695398.1 | aspartate--tRNA ligase | - |
| DQN24_RS03390 | 671424..671942 | + | 519 | WP_005688985.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| DQN24_RS03395 | 671996..672721 | + | 726 | WP_111695399.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
| DQN24_RS03400 | 672814..673050 | + | 237 | WP_005656316.1 | antitoxin | Antitoxin |
| DQN24_RS03405 | 673047..673451 | + | 405 | WP_021035685.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DQN24_RS03410 | 673518..673925 | + | 408 | WP_005688980.1 | lactoylglutathione lyase | - |
| DQN24_RS03415 | 673999..674688 | + | 690 | WP_021035684.1 | ribonuclease T | - |
| DQN24_RS03420 | 675002..676354 | + | 1353 | WP_021035683.1 | Na+/H+ antiporter family protein | - |
| DQN24_RS03425 | 676387..676971 | + | 585 | WP_021035682.1 | primosomal replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15690.26 Da Isoelectric Point: 8.9777
>T292521 WP_021035685.1 NZ_LS483411:673047-673451 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFSSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFSSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A121YHB9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3PN67 |