Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
| Location | 331553..332201 | Replicon | chromosome |
| Accession | NZ_LS483411 | ||
| Organism | Haemophilus influenzae strain NCTC11426 | ||
Toxin (Protein)
| Gene name | toxT | Uniprot ID | A0A0Y7JUP0 |
| Locus tag | DQN24_RS01645 | Protein ID | WP_005694481.1 |
| Coordinates | 331553..331912 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | DQN24_RS01650 | Protein ID | WP_005650837.1 |
| Coordinates | 331905..332201 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN24_RS01640 | 328261..331283 | + | 3023 | Protein_318 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| DQN24_RS01645 | 331553..331912 | + | 360 | WP_005694481.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQN24_RS01650 | 331905..332201 | + | 297 | WP_005650837.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| DQN24_RS01655 | 332385..334301 | + | 1917 | WP_111695306.1 | ABC transporter ATP-binding protein | - |
| DQN24_RS01660 | 334311..334847 | + | 537 | WP_111695307.1 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| DQN24_RS01665 | 334863..335414 | + | 552 | WP_042593999.1 | Sua5/YciO/YrdC/YwlC family protein | - |
| DQN24_RS01670 | 335418..336236 | + | 819 | WP_111695308.1 | shikimate dehydrogenase | - |
| DQN24_RS01675 | 336233..336790 | + | 558 | WP_111695309.1 | DNA-3-methyladenine glycosylase I | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 14321.67 Da Isoelectric Point: 10.1408
>T292520 WP_005694481.1 NZ_LS483411:331553-331912 [Haemophilus influenzae]
MYEILFYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
MYEILFYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|