Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 247683..248287 | Replicon | chromosome |
Accession | NZ_LS483411 | ||
Organism | Haemophilus influenzae strain NCTC11426 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2S9RBL9 |
Locus tag | DQN24_RS01250 | Protein ID | WP_050948779.1 |
Coordinates | 247979..248287 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q4QMK8 |
Locus tag | DQN24_RS01245 | Protein ID | WP_005692346.1 |
Coordinates | 247683..247979 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN24_RS01230 | 243449..244834 | + | 1386 | WP_111695272.1 | L-seryl-tRNA(Sec) selenium transferase | - |
DQN24_RS01235 | 244831..246690 | + | 1860 | WP_111695273.1 | selenocysteine-specific translation elongation factor | - |
DQN24_RS01240 | 246709..247563 | + | 855 | WP_050951468.1 | DUF3298 domain-containing protein | - |
DQN24_RS01245 | 247683..247979 | + | 297 | WP_005692346.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DQN24_RS01250 | 247979..248287 | + | 309 | WP_050948779.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
DQN24_RS01255 | 248345..251509 | - | 3165 | WP_111695274.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
DQN24_RS01260 | 251810..253108 | + | 1299 | WP_006995277.1 | trigger factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11949.72 Da Isoelectric Point: 7.8657
>T292519 WP_050948779.1 NZ_LS483411:247979-248287 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IRDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IRDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S9RBL9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4QMK8 |